Entry information : DsMnP01 (mnp1)
Entry ID 2341
Creation 2006-07-26 (Christophe Dunand)
Last sequence changes 2012-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-09-21 (Christophe Dunand)
Peroxidase information: DsMnP01 (mnp1)
Name (synonym) DsMnP01 (mnp1)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsMnP01
start..stop
S start..stop
DsMnP02 647 0 1..390 1..389
DsMnP03 635 0 1..390 1..387
DsMnP04 627 0 1..391 1..390
PrMnP02 623 0 1..391 1..389
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 94495..94629 135 N° 2 94384..94435 52 N° 3 94302..94328 27 N° 4 94209..94248 40
N° 5 93975..94152 178 N° 6 93690..93911 222 N° 7 93220..93634 415 N° 8 93028..93149 122
complement(join(93028..93149,93220..93634,93690..93911,93975..94152,94209..94248 ,94302..94328,94384..94435,94495..94629))


exon

Literature and cross-references DsMnP01 (mnp1)
Literature Li D., Li N., Ma B., Mayfield M.B., Gold M.H. Characterization of genes encoding two manganese peroxidases from the lignin-degrading fungus Dichomitus squalens(1). Biochim. Biophys. Acta 1434:356-364(1999).
Protein ref. UniProtKB:   Q9P902
DNA ref. JGI genome:   scaffold_68 (94629..93028)
Protein sequence: DsMnP01 (mnp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   396 (376)
PWM (Da):   %s   41216.81 (39141.7)  
PI (pH):   %s   3.72 (3.68) Peptide Signal:   %s   cut: 21 range:21-396
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKWSSILALVTLATLASAAPTQSTVTCSDGTVVPDSVCCEFIPLREALNDQVIQSDCGEDAHELLRLTFHDAIAISQSLGPSAGGGADGSMLLFPTVEPAFFANLGIADSVNNLIPFMSQFPNISPGDLVQFAGAVAITNCGAPQLEFLAGRPNGTAPAIDGLIPEPQDSIDDILARFDDAGGFTPFEVVSLLASHTVARADHVDPTLDAAPFDSTPFTFDTQIFLEVLLKGTGFPGTDNNTGEVASPIPVTNGTDVGELRLQSDFGLAHDSRTACFWQGFVNQQDFMAQSFKAAMAKLAVLGHNAADLVNCSAVIPTPLPATGKPATFPATLGPDDLELSCTTEPFPSLTTDPGAQETLIPHCSDGSMDCESVQFDGPATNFGGDDDDDDDS

Retrieve as FASTA  
Remarks Complete sequence from genomic sequence (7 introns). Strain="CBS432.34".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGTGGTCGTCCATCCTCGCCCTCGTCACCCTCGCTACGTTGGCGAGTGCTGCGCCAACTCAGTCAACAGTCACCTGTTCCGACGGCACCGTAGTTCCAGACTCAGTGTGC
TGCGAGTTCATTCCG
GTAGGTCGTGGTTGCGCTACGCTGTGATATGCTCGACACTCAAATGACATGCCATGTAGCTCAGGGAGGCACTCAACGACCAGGTCATCCAGAGCGATTGTGGTG
AAGATG
GTAGGTCGATTGTATGTGATAGTAATGATCACGGTCTCACGCTCTACTACTCCAGCTCACGAGCTTCTCCGTCTCACTTTCCGTAAGCCCTCTGCATTCGTACAGCGTCGGTGA
GGTACTAAACATACTGCGCAGACGATGCCATTGCCATCTCGCAGAGCTTGGGTCCCTCGGCGTGAGTAGCAGCCAAGCTCTATGACAAGTCCGGAGCTGATCACAATTGATATGCAGTGG
TGGAGGAGCTGACGGTTCGATGCTCCTGTTCCCAACCGTCGAGCCGGCCTTCTTCGCCAATCTCGGTATCGCCGACAGTGTCAACAACCTGATCCCGTTCATGTCGCAGTTCCCCAACAT
CTCCCCCGGTGATCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GTGCGTACATACCGTTCTTCTCACACCACGTGACTTGCCGTGCTAATGACTTTTCTTCATTAGGG
TGCACCTCAGCTCGAATTCCTTGCCGGTCGTCCCAACGGTACCGCCCCCGCCATCGACGGCCTCATCCCAGAGCCCCAGGACAGCATCGACGACATTCTGGCCCGCTTCGACGATGCAGG
AGGCTTCACGCCCTTCGAGGTCGTCTCCCTCCTCGCTTCGCACACCGTCGCCCGTGCGGACCACGTCGACCCCACGCTCGACGCTGCGCCCTTCGACAGT
GTGAGTAACGTGATCTCCTT
TGTTCGAAATGCTCTCTAAGGTCATACCCTCCCAGACGCCCTTCACTTTTGACACCCAGATCTTCCTGGAGGTCCTTCTCAAGGGTACCGGCTTCCCCGGAACGGACAACAACACCGGCG
AGGTCGCCTCTCCTATCCCCGTCACGAACGGCACCGACGTTGGCGAGCTCCGCCTCCAATCTGACTTCGGCCTCGCCCACGACTCGCGCACCGCGTGCTTCTGGCAGGGCTTCGTCAACC
AGCAGGACTTCATGGCCCAGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACGCCGCGGACCTCGTCAACTGCTCCGCCGTCATCCCCACGCCCCTGCCCGCCACCG
GAAAGCCCGCCACGTTCCCGGCTACCTTGGGCCCCGACGACCTCGAGCTCTCGTGCACGACCGAGCCGTTCCCGTCCCTCACCACCGACC
GTGAGTGTCATGGTTTCTGTTCGCGGTCGC
CGTATCATGCAGTGGCGCTGACAGCGACTCTTCCCTACAGCCGGTGCCCAGGAGACTCTCATCCCTCACTGCTCGGACGGCAGCATGGACTGCGAGTCCGTCCAGTTCGACGGTCCTGCT
ACCAACTTCGGTGGCGACGACGACGACGACGACGACTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGTGGTCGTCCATCCTCGCCCTCGTCACCCTCGCTACGTTGGCGAGTGCTGCGCCAACTCAGTCAACAGTCACCTGTTCCGACGGCACCGTAGTTCCAGACTCAGTGTGC
TGCGAGTTCATTCCG
CTCAGGGAGGCACTCAACGACCAGGTCATCCAGAGCGATTGTGGTGAAGATGCTCACGAGCTTCTCCGTCTCACTTTCCACGATGCCATTGCCATCTCGCAGAGC
TTGGGTCCCTCGGC
TGGTGGAGGAGCTGACGGTTCGATGCTCCTGTTCCCAACCGTCGAGCCGGCCTTCTTCGCCAATCTCGGTATCGCCGACAGTGTCAACAACCTGATCCCGTTCATG
TCGCAGTTCCCCAACATCTCCCCCGGTGATCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GGTGCACCTCAGCTCGAATTCCTTGCCGGTCGTCCCAACGGTACCGCC
CCCGCCATCGACGGCCTCATCCCAGAGCCCCAGGACAGCATCGACGACATTCTGGCCCGCTTCGACGATGCAGGAGGCTTCACGCCCTTCGAGGTCGTCTCCCTCCTCGCTTCGCACACC
GTCGCCCGTGCGGACCACGTCGACCCCACGCTCGACGCTGCGCCCTTCGACAGT
ACGCCCTTCACTTTTGACACCCAGATCTTCCTGGAGGTCCTTCTCAAGGGTACCGGCTTCCCCGGA
ACGGACAACAACACCGGCGAGGTCGCCTCTCCTATCCCCGTCACGAACGGCACCGACGTTGGCGAGCTCCGCCTCCAATCTGACTTCGGCCTCGCCCACGACTCGCGCACCGCGTGCTTC
TGGCAGGGCTTCGTCAACCAGCAGGACTTCATGGCCCAGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACGCCGCGGACCTCGTCAACTGCTCCGCCGTCATCCCC
ACGCCCCTGCCCGCCACCGGAAAGCCCGCCACGTTCCCGGCTACCTTGGGCCCCGACGACCTCGAGCTCTCGTGCACGACCGAGCCGTTCCCGTCCCTCACCACCGACC
CCGGTGCCCAG
GAGACTCTCATCCCTCACTGCTCGGACGGCAGCATGGACTGCGAGTCCGTCCAGTTCGACGGTCCTGCTACCAACTTCGGTGGCGACGACGACGACGACGACGACTCTTAG

Retrieve as FASTA