Entry information : TvLiP02_PRL572 (LiPGIII)
Entry ID 2344
Creation 2006-09-01 (Christophe Dunand)
Last sequence changes 2011-10-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-10-05 (Christophe Dunand)
Peroxidase information: TvLiP02_PRL572 (LiPGIII)
Name (synonym) TvLiP02_PRL572 (LiPGIII)
Class Lignin peroxidase    [Orthogroup: LiP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type Hyphae
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvLiP02_PRL572
start..stop
S start..stop
TvLiP02 735 0 1..367 1..367
TvLiP12_PRL572 618 0 1..367 1..367
TvLiP12 618 0 1..367 1..367
TvLiP08 597 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 357..417 61 N° 2 486..693 208 N° 3 754..888 135 N° 4 944..1490 547
N° 5 1547..1621 75 N° 6 1683..1747 65 N° 7 1807..1819 13  
join(357..417,486..693,754..888,944..1490,1547..1621,1683..1747,1807..1819)


exon

Literature and cross-references TvLiP02_PRL572 (LiPGIII)
Literature Johansson T., Nyman P.O. A cluster of genes encoding major isozymes of lignin peroxidase and manganese peroxidase from the white-rot fungus Trametes versicolor. Gene 170:31-38(1996).
Protein ref. UniProtKB:   Q12435
DNA ref. GenBank:   Z30666
Protein sequence: TvLiP02_PRL572 (LiPGIII)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (346)
PWM (Da):   %s   38688.16 (36554.0)  
PI (pH):   %s   3.99 (3.95) Peptide Signal:   %s   cut: 22 range:22-367
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKTLLSIVSLLAAFQGATAALTRRVACPDGVNTATNAACCQLFAVRDDLQENLFHGGLCTAEAHESLRLTFHDAIAISPALEQQGIFGGGGADGSIAIFSDIETAFHPNIGLDEIVELQKPFIARHNLSVADFIQFAGAIGASNCAGAPQLAAFVGRVDATQPAPDGLVPEPFHTPDQIFARLADASQGEFDEILTVWLLVAHTVAAANDVDPTVPGSPFDSTPEVWDTQFFVEVLLNGTTFPGTGDNQGEVASPIAGEFRLQSDFAIARDSRSACEWQSFVDNQPKAQAMFQFVFHDLSIFGQDINSLVDCTEVPIPAPLQGVTHFPAGLTVNDIDQPCVETPFPTLPTDPGPATSVAPVPLP

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Forms a cluster with TvLiP (LPGIV) and TvMnP02_PRL572 (MPGI). Strain="PRL572".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACCTTACTCTCCATCGTCTCCCTTTTGGCGGCGTTCCAGGGCGCGACCGGTACGTGGCTAGCGCGGCCGACGTCGACATCATTTGTCAAGACTATCTGACGTCTTTTC
ATCCGCTAGCCGCATTGACCCGCCGCGTCGCTTGCCCCGACGGAGTGAACACCGCGACTAACGCGGCGTGCTGCCAGCTCTTCGCTGTGCGCGACGACCTCCAGGAGAACCTGTTCCACG
GCGGTCTCTGCACGGCCGAGGCGCACGAGTCTCTTCGCCTGACGTTCCACGACGCCATCGCCATCTCCCCTGCTCTTGAGCAGCAGGGTATCTTTGG
GTATGTCTAGCACGTTGTAAGCA
TTCAAGACATCGTTATTGATGACACTCTACTGCACAGTGGCGGAGGTGCCGATGGGTCCATCGCGATCTTCTCCGACATCGAGACCGCCTTCCACCCCAACATCGGTCTTGACGAGATCG
TCGAGCTCCAGAAGCCGTTCATCGCGCGTCACAACCTCTCCGTCGCTGACTT
GTAAGCTCCACTGTTGATGATGCGACTATAATAACATGCTAACTCGTCGCTATAGTATTCAATTCGCC
GGAGCCATCGGTGCCTCGAACTGCGCGGGTGCTCCCCAACTTGCCGCCTTCGTCGGCCGCGTGGATGCTACTCAGCCCGCACCCGACGGTCTCGTCCCCGAGCCATTCCACACCCCGGAC
CAGATCTTCGCCCGCCTCGCCGACGCGTCCCAGGGCGAGTTCGACGAGATCTTGACTGTGTGGCTCCTCGTCGCCCACACCGTCGCCGCGGCGAACGACGTCGACCCGACCGTCCCCGGC
TCGCCCTTCGACTCGACCCCGGAGGTCTGGGACACGCAGTTCTTCGTCGAGGTCCTTCTGAACGGCACGACCTTCCCCGGCACCGGCGACAACCAGGGTGAGGTCGCGTCCCCGATCGCC
GGCGAGTTCCGCCTGCAGTCCGACTTCGCGATCGCGCGCGACAGCCGCTCCGCGTGCGAGTGGCAGTCGTTCGTCGACAACCAGCCCAAGGCGCAGGCGATGTTCCAGTTCGTGTTCCAC
GACCTTTCCATCTTCGGCCAGGACATCAACTCGCTCGTCGACTGCACGGAAGTT
GTGCGTGTTTCTGCTCCTATAGAACGTTTTAGACACCAACTAACCAGCAAGCATAGGTTCCGATTC
CGGCACCGCTCCAGGGCGTGACCCACTTCCCCGCTGGTTTGACCGTCAACGACATCGACCAGCCT
GTACGTATTTCTGATACAGCCCTAGCTTGTTGCAGTACTGATCACCAGCTATCTC
GGACAGTGCGTCGAGACCCCCTTCCCCACTCTCCCGACTGACCCCGGTCCCGCGACCTCTGTCGCCCCCGTGTAAGTTTTCAGCTATGATCGATATGACTAGTCACTTACTACAGCCTTT
TGTTTCATAGCCCCCTTCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAACCTTACTCTCCATCGTCTCCCTTTTGGCGGCGTTCCAGGGCGCGACCGCCGCATTGACCCGCCGCGTCGCTTGCCCCGACGGAGTGAACACCGCGACTAACGCGGCG
TGCTGCCAGCTCTTCGCTGTGCGCGACGACCTCCAGGAGAACCTGTTCCACGGCGGTCTCTGCACGGCCGAGGCGCACGAGTCTCTTCGCCTGACGTTCCACGACGCCATCGCCATCTCC
CCTGCTCTTGAGCAGCAGGGTATCTTTGG
TGGCGGAGGTGCCGATGGGTCCATCGCGATCTTCTCCGACATCGAGACCGCCTTCCACCCCAACATCGGTCTTGACGAGATCGTCGAGCTC
CAGAAGCCGTTCATCGCGCGTCACAACCTCTCCGTCGCTGACTT
TATTCAATTCGCCGGAGCCATCGGTGCCTCGAACTGCGCGGGTGCTCCCCAACTTGCCGCCTTCGTCGGCCGCGTG
GATGCTACTCAGCCCGCACCCGACGGTCTCGTCCCCGAGCCATTCCACACCCCGGACCAGATCTTCGCCCGCCTCGCCGACGCGTCCCAGGGCGAGTTCGACGAGATCTTGACTGTGTGG
CTCCTCGTCGCCCACACCGTCGCCGCGGCGAACGACGTCGACCCGACCGTCCCCGGCTCGCCCTTCGACTCGACCCCGGAGGTCTGGGACACGCAGTTCTTCGTCGAGGTCCTTCTGAAC
GGCACGACCTTCCCCGGCACCGGCGACAACCAGGGTGAGGTCGCGTCCCCGATCGCCGGCGAGTTCCGCCTGCAGTCCGACTTCGCGATCGCGCGCGACAGCCGCTCCGCGTGCGAGTGG
CAGTCGTTCGTCGACAACCAGCCCAAGGCGCAGGCGATGTTCCAGTTCGTGTTCCACGACCTTTCCATCTTCGGCCAGGACATCAACTCGCTCGTCGACTGCACGGAAGTT
GTTCCGATT
CCGGCACCGCTCCAGGGCGTGACCCACTTCCCCGCTGGTTTGACCGTCAACGACATCGACCAGCCT
TGCGTCGAGACCCCCTTCCCCACTCTCCCGACTGACCCCGGTCCCGCGACCTCT
GTCGCCCCCGT
CCCCCTTCCGTGA

Retrieve as FASTA