1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx69 (At5g64100 / PER69 / AtP69)
Entry ID 235
Creation 2006-02-07 (Filippo Passardi)
Last sequence changes 2015-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx69 (At5g64100 / PER69 / AtP69)
Name (synonym) AtPrx69 (At5g64100 / PER69 / AtP69)
Class Class III peroxidase    [Orthogroup: Prx076]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Seedlings
Inducers Cold stress
Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx69
start..stop		 S start..stop
AlyPrx69 605 0 1..331 1..332
CagraPrx72 592 0 1..331 1..331
CrubPrx53 584 0 1..331 1..331
TsPrx69 573 0 1..331 1..333
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx69 (At5g64100 / PER69 / AtP69)
Literature REFERENCE 1 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
Protein ref. UniProtKB:   Q96511
DNA ref. Phytozome 12:   Chr5 (25652062..25650824)
mRNA ref. GenBank:   NM_125806
Cluster/Prediction ref. Phytozome Gene 12:   19673191 UniGene:   At.25608
Omic ref. AtProteome:   At5g64100 ATTED-II:   At5g64100 e-FP Browser:   At5g64100 ePlant:   At5g64100 Genevestigator:   At5g64100 TAIR:   At5g64100
Protein sequence: AtPrx69 (At5g64100 / PER69 / AtP69)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (308)
PWM (Da):   %s   35542.57 (33094.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.73 (9.53) Peptide Signal:   %s   cut: 24 range:24-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRGYNLLFVLVTFLVLVAAVTAQGNRGSNSGGGRRPHVGFYGNR
CRNVESIVRSVVQSHVRSIPANAPGILRMHFHDCFVHGCDGSVLLAGNTSERTAVPNRSLRGFEVIEEAKARLEK
ACPRTVSCADILTLAARDAVVLTGGQRWEVPLGRLDGRISQASDVNLPGPSDSVAKQKQDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFVNFNGTGQPDPSIDPSFVPLILAQCPQN
GGTRVELDEGSVDKFDTSFLRKVTSSRVVLQSDLVLWKDPETRAIIERLLGLRRPSLRFGTEFGKSMVKMSLIEVKTGSDGEIRRVCSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3), 6 cDNA and 113 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST