Entry information : CsuMnP02 (mnp2 / mnp2B)
Entry ID 2374
Creation 2006-08-29 (Christophe Dunand)
Last sequence changes 2011-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP02 (mnp2 / mnp2B)
Name (synonym) CsuMnP02 (mnp2 / mnp2B)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP02
start..stop
S start..stop
PgigMnP04 644 0 1..382 1..388
CsuMnP10 633 0 1..382 1..378
CsuMnP05 632 0 1..382 1..377
CsuMnP11 632 0 1..382 1..382
Gene structure Fichier Exons


exon

Literature and cross-references CsuMnP02 (mnp2 / mnp2B)
Literature Tello,M., Corsini,G., Larrondo,L.F., Salas,L., Lobos,S. and Vicuna,R. Characterization of three new manganese peroxidase genes from the ligninolytic basidiomycete Ceriporiopsis subvermispora Biochim. Biophys. Acta 1490 (1-2), 137-144 (2000)
Protein ref. UniProtKB:   Q9UW39  Q9UW40
DNA ref. JGI genome:   scaffold_6 (1535152..1533603)
Protein sequence: CsuMnP02 (mnp2 / mnp2B)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   387 (369)
PWM (Da):   %s   40829.94 (39015.9)  
PI (pH):   %s   4.21 (4.17) Peptide Signal:   %s   cut: 19 range:19-387
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLALVALAAITRAAPTTICPDGTRVSNHVCCDFIPLAQALQSTLYMGDCGEDAHETIRLTFHDAIAISQSQGPSAGGGADGSMLIFPTVEPFFHANAGIDDSVNNLIPFLDKFPTITAGDLIQFAGTVALSNCGAPQLEFLAGRPNATAPAVDGL
IPEPQDNVTHILERFADAGGFTPFEVVSLLASHTVARADKVDLTIDAAPFDS
TPFTFDTQIFLEVLLKGVGFPGTDNNTGEVESPLPLGNNKQGGNDTGEMRLQSDFALARDDRTACFWQ
GFVNEQEYMMSSFKAAMSKLAILGHNRNDLIDCSEVVPTPKPPVGKPASFPATTGPQDLQLTCKSERFPSLTID
HGAQETLIPHCSNGGQDCPTVQFTGPAGEDDS

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (7 introns). Strain="FP 105752". Two SwissProt accessions coming from DNA (AF161078 and AF161584) with 100%. No duplications found in the genome.
DNA
Send to BLAST
CDS
Send to BLAST