Entry information : CsuMnP03
Entry ID 2375
Creation 2005-10-07 (Christophe Dunand)
Last sequence changes 2012-04-02 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: CsuMnP03
Name CsuMnP03
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP03
start..stop
S start..stop
CsuMnP01 715 0 15..389 15..389
CsuMnP12 634 0 1..386 1..386
CsuMnP08 615 0 1..385 1..383
CsuMnP06 602 0 1..389 1..386
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 865873..866001 129 N° 2 866065..866116 52 N° 3 866174..866200 27 N° 4 866253..866292 40
N° 5 866356..866533 178 N° 6 866600..866821 222 N° 7 866882..867308 427 N° 8 867368..867462 95
join(865873..866001,866065..866116,866174..866200,866253..866292,866356..866533, 866600..866821,866882..867308,867368..867462)


exon

Literature and cross-references CsuMnP03
Literature Tello M., Corsini G., Larrondo L.F., Salas L., Lobos S., Vicuna R. Characterization of three new manganese peroxidase genes from the ligninolytic basidiomycete Ceriporiopsis subvermispora. Biochim. Biophys. Acta 1490:137-144(2000).
Protein ref. UniProtKB:   Q9UW38
DNA ref. JGI genome:   scaffold_11 (865873..867462)
Protein sequence: CsuMnP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389 (371)
PWM (Da):   %s   40124.53 (38338.5)  
PI (pH):   %s   3.81 (3.77) Peptide Signal:   %s   cut: 19 range:19-389
Sequence 430
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLAIVALAATVRGAPASSSVTCSDGTAVPDAMCCDFIPLAQDLQSMVLQNQCGEDAHEIIRLTFHDAIAISQSLGPSAGTGADGSMLLFPLVEPEFAASNGIDDSVNNLIPFLSSHPNISAGDLVQFAGAVALTNCPGAPRVNFLAGRKNAVAPAIDGLIPEPQDNVTSILARFADAGNFSPFEVVSLLASHSVARADKVDPTLDAAPFDSTPFTFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPFGDTSTGGNDTGMMRLQSDFALARDERTACFWQSFVDQQDLMAQSFQAAFEKLAILGSSAADLVNCSAVVPLSVGPVTAPATFPATTGPQDLQLTCTTETFPSLSIDPGATETLIPHCPDGSEDCPTVQFSGPATDSP

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Strain="FP 105752".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTTACATCGCTCCTCGCTATTGTCGCGCTTGCTGCTACCGTGCGCGGTGCACCGGCGTCGTCGTCTGTCACTTGCTCAGATGGCACCGCCGTACCCGACGCGATGTGCTGCGACT
TCATCCCT
GTATGTGCGATTCATTATGCTCTTCGATACTTGATCATTCATTCTGATTTATCACACAACTAGCTCGCACAGGACCTTCAGTCCATGGTTCTGCAAAACCAGTGCGGCGAAG
ACG
GTATGTGCACATATTCGCACTACAGTGCTTCAGGTCGCTGACGGCTGTCGATTCTAGCGCACGAGATCATCCGTCTCACTTTCCGTTAGCATTAGTCCCAGTTACAAGCTTGCTACA
AATTGACAGGAATATCTAGACGATGCGATTGCCATCTCCCAATCTTTGGGTCCCTCTGCGTATGTCCTTTGCTTCTTTTGCAGCAAACCAAACGCATCATTGACATTATATCGGATCTGC
AGGGGTACCGGAGCTGACGGTTCCATGCTTCTGTTCCCGCTCGTTGAGCCCGAGTTCGCGGCCAGCAACGGTATTGACGACTCCGTGAACAACTTGATTCCCTTCTTGTCGAGCCACCCG
AACATCTCTGCTGGTGATCTCGTCCAGTTCGCTGGTGCCGTTGCCCTCACGAACTGCCCT
GTCAGTACCATACCAGCATGCTAGCGCCCATTGTATTCGTTTTCTCACATATTTCCTTCT
TTGTAGGGCGCTCCACGCGTGAACTTCCTGGCGGGCCGCAAGAACGCGGTTGCCCCGGCCATTGATGGTCTGATCCCCGAGCCGCAGGACAACGTCACGAGCATCCTTGCTCGGTTTGCT
GATGCTGGCAACTTCTCGCCGTTCGAGGTCGTCTCGCTCCTGGCTTCGCACAGCGTAGCCCGTGCCGACAAGGTCGACCCGACCCTCGATGCCGCTCCTTTCGACAGT
GTCAGTGTACTT
TTTCCTTGAGACCGAGGCTTAACATGCTGACACATAGTCCAACCCTAGACGCCGTTCACTTTCGACACCCAAGTCTTCCTCGAGGTTCTCCTCAAGGGTGTCGGCTTCCCCGGAACCGAC
AACAACACTGGCGAGGTTGCGTCTCCGCTTCCGTTCGGCGATACCTCGACTGGCGGAAACGACACCGGCATGATGCGTCTCCAGTCCGACTTCGCCCTCGCGCGCGACGAGCGCACTGCT
TGCTTCTGGCAGAGCTTCGTCGACCAACAGGACTTGATGGCGCAGAGTTTCCAGGCCGCTTTCGAGAAGCTCGCCATCCTCGGCAGCAGCGCCGCGGACCTCGTCAACTGCTCCGCCGTT
GTGCCCCTATCCGTCGGGCCCGTCACTGCACCCGCGACATTCCCCGCAACCACTGGTCCCCAGGATCTCCAGCTGACCTGCACGACCGAGACGTTCCCGTCACTCAGCATCGACC
GTAAG
TCCATACTCTTATGATGCCGTCGGGATCGGAATTGATAGGTGCTTGCTCTTCAGCTGGTGCGACCGAGACCCTCATCCCTCATTGCCCCGATGGCAGCGAGGACTGCCCGACCGTCCAGT
TCTCGGGCCCAGCCACCGACTCGCCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTTACATCGCTCCTCGCTATTGTCGCGCTTGCTGCTACCGTGCGCGGTGCACCGGCGTCGTCGTCTGTCACTTGCTCAGATGGCACCGCCGTACCCGACGCGATGTGCTGCGACT
TCATCCCT
CTCGCACAGGACCTTCAGTCCATGGTTCTGCAAAACCAGTGCGGCGAAGACGCGCACGAGATCATCCGTCTCACTTTCCACGATGCGATTGCCATCTCCCAATCTTTGGGTC
CCTCTGC
GGGTACCGGAGCTGACGGTTCCATGCTTCTGTTCCCGCTCGTTGAGCCCGAGTTCGCGGCCAGCAACGGTATTGACGACTCCGTGAACAACTTGATTCCCTTCTTGTCGAGCC
ACCCGAACATCTCTGCTGGTGATCTCGTCCAGTTCGCTGGTGCCGTTGCCCTCACGAACTGCCCT
GGCGCTCCACGCGTGAACTTCCTGGCGGGCCGCAAGAACGCGGTTGCCCCGGCCA
TTGATGGTCTGATCCCCGAGCCGCAGGACAACGTCACGAGCATCCTTGCTCGGTTTGCTGATGCTGGCAACTTCTCGCCGTTCGAGGTCGTCTCGCTCCTGGCTTCGCACAGCGTAGCCC
GTGCCGACAAGGTCGACCCGACCCTCGATGCCGCTCCTTTCGACAGT
ACGCCGTTCACTTTCGACACCCAAGTCTTCCTCGAGGTTCTCCTCAAGGGTGTCGGCTTCCCCGGAACCGACA
ACAACACTGGCGAGGTTGCGTCTCCGCTTCCGTTCGGCGATACCTCGACTGGCGGAAACGACACCGGCATGATGCGTCTCCAGTCCGACTTCGCCCTCGCGCGCGACGAGCGCACTGCTT
GCTTCTGGCAGAGCTTCGTCGACCAACAGGACTTGATGGCGCAGAGTTTCCAGGCCGCTTTCGAGAAGCTCGCCATCCTCGGCAGCAGCGCCGCGGACCTCGTCAACTGCTCCGCCGTTG
TGCCCCTATCCGTCGGGCCCGTCACTGCACCCGCGACATTCCCCGCAACCACTGGTCCCCAGGATCTCCAGCTGACCTGCACGACCGAGACGTTCCCGTCACTCAGCATCGACC
CTGGTG
CGACCGAGACCCTCATCCCTCATTGCCCCGATGGCAGCGAGGACTGCCCGACCGTCCAGTTCTCGGGCCCAGCCACCGACTCGCCCTGA

Retrieve as FASTA