Entry information : CsuMnP04 (mnp4)
Entry ID 2376
Creation 2005-10-07 (Christophe Dunand)
Last sequence changes 2012-04-02 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: CsuMnP04 (mnp4)
Name (synonym) CsuMnP04 (mnp4)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP04
start..stop
S start..stop
CsuMnP05 687 0 1..377 1..377
CsuMnP10 645 0 1..377 1..378
PsoMnP02 644 0 1..377 1..377
PcMnP02_OGC101 639 0 1..377 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 476073..476192 120 N° 2 475962..476013 52 N° 3 475840..475906 67 N° 4 475605..475779 175
N° 5 475316..475537 222 N° 6 474843..475257 415 N° 7 474703..474785 83  
complement(join(474703..474785,474843..475257,475316..475537,475605..475779,4758 40..475906,475962..476013,476073..476192))


exon

Literature and cross-references CsuMnP04 (mnp4)
Literature Yaver D.S., Weber B., Murrell J. Global Expression Profiling of the Lignin Degrading Fungus Ceriporiopsis subvermispora for the Discovery of Novel Enzymes. (In) Aurora D.K., Khachatourians G.G. (eds.) APPLIED MYCOLOGY AND BIOTECHNOLOGY / FUNGAL GENOMICS, pp.0-0, Elsevier Science, 1000 AE Amsterdam, The Netherlands (2003).
Protein ref. UniProtKB:   Q873X7
DNA ref. JGI genome:   scaffold_6 (476192..474703)
Protein sequence: CsuMnP04 (mnp4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   377 (359)
PWM (Da):   %s   39235.18 (37429.2)  
PI (pH):   %s   4.1 (4.10) Peptide Signal:   %s   cut: 19 range:19-377
Sequence 418
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLFTLVVLAAVSNAAPTAVCADGTRVSNAACCAFIPLAQDLQETLFMGDCGEDAHEVIRLTFHDAVAISSSMGPSAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFLSKHAVSAGDLVQFAGAVALTNCPGAPQLEFLAGRPNHTIAAIDGLIPEPQDDVTKILARFEDAGGFSPFEVVSLLASHTVARADKVDGTIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGTNNNIGEVASPLPLTSGNDTGEMRLQSDFALARDERTACFWQSFVNEQEFMAQSFKAAMSKLAVLGHSRSSLVDCSDVVPAPKPAVNKPATFPATTGPDDLELTCTAERFPTLSVDPGAQQTLIPHCSDGDQVCATVQFTGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCCTCTCTCTTTACCCTCGTTGTGCTCGCCGCAGTCTCAAACGCTGCACCGACTGCTGTCTGCGCTGACGGCACTCGCGTCAGCAATGCAGCCTGCTGCGCCTTCATCCCA
GTATGCGCACCGCTTCTGCACTCGATGTGTTGTCATGATGCTGATGGGACCGATCGTAGCTCGCACAGGACCTGCAAGAGACGCTCTTCATGGGCGACTGCGGAGAAGATGGTGAATATT
CGAGTTTCCTCACATTTTCTCCGTCGCACTCATCTAAATCCTCTAGCTCACGAGGTCATCCGGTTGACCTTCCACGACGCTGTTGCGATCTCCAGCAGCATGGGCCCCTCTGCGTATGTC
CTGTCAATGTGTACATTCGGATCATAGGACTAATGTCACTGCTCACTTTGCAGCGGCGGTGGAGCTGACGGTTCGATGCTTTTGTTCCCAACGGTCGAGCCAAATTTCTCGGCCAACAAC
GGTATCGACGACTCCGTGAACAACCTCATTCCCTTCCTGTCGAAGCACGCCGTTAGCGCGGGTGATCTCGTTCAGTTTGCGGGTGCTGTCGCTTTGACCAACTGTCCT
GTGAGTGACTGA
TTGCCCAAATGTGTTTCCTACGCATTGGCTCATGTCCACATTTGATACATTTCAGGGCGCTCCTCAGCTCGAGTTCTTGGCTGGTCGCCCTAACCACACCATCGCTGCCATCGATGGCCT
GATCCCTGAGCCTCAGGACGATGTCACCAAGATTCTCGCACGCTTCGAAGATGCCGGAGGCTTCAGCCCCTTCGAAGTTGTCTCACTCCTGGCTTCCCACACCGTCGCCCGCGCTGACAA
GGTCGATGGGACCATTGATGCGGCACCTTTCGACTCG
GTCAGTGCTCGTCTGAAACTCAAGCTTCGTGCTTTATATTGACATCGTGGTACACTAGACCCCGTTCACCTTCGACACTCAGG
TATTCCTTGAGGTGCTGCTCAAGGGTACTGGTTTCCCTGGAACCAACAACAACATTGGCGAGGTTGCGTCTCCTCTCCCACTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGT
CCGACTTTGCTCTTGCCCGCGACGAACGCACTGCTTGCTTCTGGCAGAGCTTCGTCAACGAGCAGGAGTTCATGGCACAAAGCTTCAAGGCCGCGATGTCCAAGCTCGCAGTCCTCGGCC
ACAGCCGCTCGAGCCTAGTCGACTGCTCAGACGTCGTCCCCGCGCCGAAGCCTGCCGTGAACAAGCCCGCGACGTTCCCCGCCACCACTGGTCCAGATGACCTCGAGCTCACCTGCACGG
CAGAGCGCTTCCCGACACTCTCCGTTGACC
GTGAGTGTCTCAGCCTCAGTGATACAGATGCATGATTGACCTTGATGTCTTCGATAGCTGGTGCGCAGCAGACGCTCATTCCGCACTGCT
CCGACGGTGACCAGGTATGCGCGACCGTCCAATTTACTGGCCCTGCTTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCCTCTCTCTTTACCCTCGTTGTGCTCGCCGCAGTCTCAAACGCTGCACCGACTGCTGTCTGCGCTGACGGCACTCGCGTCAGCAATGCAGCCTGCTGCGCCTTCATCCCA
CTCGCACAGGACCTGCAAGAGACGCTCTTCATGGGCGACTGCGGAGAAGATGCTCACGAGGTCATCCGGTTGACCTTCCACGACGCTGTTGCGATCTCCAGCAGCATGGGCCCCTCTGCC
GGCGGTGGAGCTGACGGTTCGATGCTTTTGTTCCCAACGGTCGAGCCAAATTTCTCGGCCAACAACGGTATCGACGACTCCGTGAACAACCTCATTCCCTTCCTGTCGAAGCACGCCGTT
AGCGCGGGTGATCTCGTTCAGTTTGCGGGTGCTGTCGCTTTGACCAACTGTCCT
GGCGCTCCTCAGCTCGAGTTCTTGGCTGGTCGCCCTAACCACACCATCGCTGCCATCGATGGCCTG
ATCCCTGAGCCTCAGGACGATGTCACCAAGATTCTCGCACGCTTCGAAGATGCCGGAGGCTTCAGCCCCTTCGAAGTTGTCTCACTCCTGGCTTCCCACACCGTCGCCCGCGCTGACAAG
GTCGATGGGACCATTGATGCGGCACCTTTCGACTCG
ACCCCGTTCACCTTCGACACTCAGGTATTCCTTGAGGTGCTGCTCAAGGGTACTGGTTTCCCTGGAACCAACAACAACATTGGC
GAGGTTGCGTCTCCTCTCCCACTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGTCCGACTTTGCTCTTGCCCGCGACGAACGCACTGCTTGCTTCTGGCAGAGCTTCGTCAAC
GAGCAGGAGTTCATGGCACAAAGCTTCAAGGCCGCGATGTCCAAGCTCGCAGTCCTCGGCCACAGCCGCTCGAGCCTAGTCGACTGCTCAGACGTCGTCCCCGCGCCGAAGCCTGCCGTG
AACAAGCCCGCGACGTTCCCCGCCACCACTGGTCCAGATGACCTCGAGCTCACCTGCACGGCAGAGCGCTTCCCGACACTCTCCGTTGACC
CTGGTGCGCAGCAGACGCTCATTCCGCAC
TGCTCCGACGGTGACCAGGTATGCGCGACCGTCCAATTTACTGGCCCTGCTTA

Retrieve as FASTA