Entry information : CsuMnP01 (mnp1)
Entry ID 2377
Creation 2005-10-07 (Christophe Dunand)
Last sequence changes 2011-11-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP01 (mnp1)
Name (synonym) CsuMnP01 (mnp1)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP01
start..stop
S start..stop
CsuMnP03 737 0 1..389 1..389
CsuMnP12 622 0 1..386 1..386
CsuMnP08 608 0 1..385 1..383
CsuMnP06 604 0 1..389 1..386
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 869417..869545 129 N° 2 869606..869657 52 N° 3 869714..869740 27 N° 4 869792..869831 40
N° 5 869893..870070 178 N° 6 870132..870353 222 N° 7 870413..870839 427 N° 8 870896..870990 95
join(869417..869545,869606..869657,869714..869740,869792..869831,869893..870070, 870132..870353,870413..870839,870896..870990)


exon

Literature and cross-references CsuMnP01 (mnp1)
Literature Lobos,S., Larrondo,L., Salas,L., Karahanian,E. and Vicuna,R. Cloning and molecular analysis of a cDNA and the Cs-mnp1 gene encoding a manganese peroxidase isoenzyme from the lignin-degrading basidiomycete Ceriporiopsis subvermispora. Gene 206 (2), 185-193 (1998)
Protein ref. UniProtKB:   Q12597
DNA ref. JGI genome:   scaffold_11 (869417..870990)
mRNA ref. GenBank:   U60413
Protein sequence: CsuMnP01 (mnp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389 (371)
PWM (Da):   %s   40355.61 (38585.6)  
PI (pH):   %s   3.81 (3.77) Peptide Signal:   %s   cut: 19 range:19-389
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLLALVALAATVRAAPSSSSVTCSDGTVVPDSMCCDFIPLAQDLQSMVLQNECGEDAHEIIRLTFHDAIAISQSLGPSAGTGADGSMLLFPLVEPEFQASNGIDDSVNNLIPFLSSHPNITAGDLVQFAGAVALTNCGAPRVNFLAGRKNAVAPAIDGLIPVPQDNVSTILARFADAGNFSPFEVVSLLASHSVARADKVDPTLDAAPFDTTPFTFDTQIFLEVLLKGVGFPGLDNNTGEVASPLPFGDTSTGGNDTGMMRLQSDFALARDERTACFWQGFVDQQDFMAQSFQAAFEKMAILGSNAADLINCSAVVPQSVGPVTVPATFPATTGPQDLQLNCTSETFPSLSIDPGATETLIPHCPDGTEDCPSVQFSGPATDSP

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and mRNA. Probable sequencing errors between the two genomic accessions. Strain="FP 105752".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCATCACTCCTCGCTCTTGTCGCGCTTGCTGCCACTGTGCGAGCTGCGCCGTCCTCGTCGTCTGTCACTTGCTCAGACGGTACTGTCGTCCCCGACTCGATGTGCTGCGAC
TTCATTCCT
GTACGCGCTCTTTCTTCGGTTTTCGATGCTTAGTTGTGTTTATTTCTATCCGCAAATTAGCTCGCGCAAGACCTACAGTCTATGGTTCTGCAAAATGAGTGTGGTGAAGAT
G
GTGTGCACAAGTCAATGCTCTGCGGTGCTCCAAGTGCTGACTTTCATTCATTTTAGCTCACGAGATCATCCGTCTCACTTTCCGTCAGTAACAATTCTAAATCGATTGTTCTCCGAATT
TATAGTAGCCTCTAGATGATGCCATTGCCATCTCCCAATCTCTGGGTCCTTCTGCGTATGTCCTTCACTTCTTTTGTAGCACACGAGTCGCGTGGTTAACATTATTCGATCTACAGGGGA
ACCGGAGCTGACGGTTCCATGCTTCTGTTCCCGCTCGTTGAGCCCGAATTCCAGGCCAGCAACGGTATTGACGACTCCGTGAACAACTTGATCCCCTTCCTATCGAGCCACCCGAACATC
ACCGCTGGTGATCTCGTCCAGTTCGCTGGTGCAGTCGCCCTCACGAACTGTCCT
GTCAGTACCGGTGTTCCGAGGTCCATTGAACCGGTTTGCTCACATGTCTTTTTGTTTGCAGGGCGC
TCCGCGCGTGAACTTCCTGGCGGGCCGCAAGAACGCGGTTGCCCCGGCCATTGATGGTCTGATCCCCGTGCCGCAGGACAACGTCTCCACCATTCTTGCTCGCTTTGCCGATGCTGGCAA
CTTCTCGCCGTTCGAGGTCGTCTCGCTCCTGGCCTCGCACAGTGTGGCGCGGGCCGACAAGGTCGACCCGACCCTTGATGCCGCTCCCTTCGACACC
GTGAGTGCCTTTCATCCTTGAGA
CCGAGGATTGCCTGCTGATACGTGCTGCATCTCTAGACTCCCTTCACTTTCGATACCCAAATTTTCCTCGAAGTTCTTCTCAAAGGCGTCGGCTTCCCTGGATTGGACAACAACACCGGT
GAGGTCGCGTCCCCGCTTCCATTCGGTGACACCTCGACTGGCGGCAACGACACCGGCATGATGCGCCTCCAGTCTGACTTCGCCCTTGCACGCGACGAGCGCACTGCTTGCTTCTGGCAG
GGCTTCGTCGACCAGCAGGACTTCATGGCACAGAGTTTCCAGGCTGCTTTCGAGAAGATGGCGATCCTCGGTAGCAACGCCGCGGACCTCATCAACTGCTCCGCTGTCGTGCCCCAGTCT
GTCGGCCCCGTCACCGTGCCCGCGACGTTCCCCGCGACGACCGGCCCCCAGGATCTCCAGCTTAACTGCACCTCTGAGACGTTCCCGTCGCTCAGCATTGACC
GTAAGTCCGGCGCCGTT
GAAGCTCCGAGGAACGAGACTGATAGGTGCTTGCTCTAGCGGGTGCGACCGAGACCCTCATCCCGCACTGCCCCGATGGTACCGAGGACTGCCCGTCCGTCCAGTTCTCGGGCCCGGCCA
CCGACTCGCCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCATCACTCCTCGCTCTTGTCGCGCTTGCTGCCACTGTGCGAGCTGCGCCGTCCTCGTCGTCTGTCACTTGCTCAGACGGTACTGTCGTCCCCGACTCGATGTGCTGCGAC
TTCATTCCT
CTCGCGCAAGACCTACAGTCTATGGTTCTGCAAAATGAGTGTGGTGAAGATGCTCACGAGATCATCCGTCTCACTTTCCATGATGCCATTGCCATCTCCCAATCTCTGGGT
CCTTCTGC
GGGAACCGGAGCTGACGGTTCCATGCTTCTGTTCCCGCTCGTTGAGCCCGAATTCCAGGCCAGCAACGGTATTGACGACTCCGTGAACAACTTGATCCCCTTCCTATCGAGC
CACCCGAACATCACCGCTGGTGATCTCGTCCAGTTCGCTGGTGCAGTCGCCCTCACGAACTGTCCT
GGCGCTCCGCGCGTGAACTTCCTGGCGGGCCGCAAGAACGCGGTTGCCCCGGCC
ATTGATGGTCTGATCCCCGTGCCGCAGGACAACGTCTCCACCATTCTTGCTCGCTTTGCCGATGCTGGCAACTTCTCGCCGTTCGAGGTCGTCTCGCTCCTGGCCTCGCACAGTGTGGCG
CGGGCCGACAAGGTCGACCCGACCCTTGATGCCGCTCCCTTCGACACC
ACTCCCTTCACTTTCGATACCCAAATTTTCCTCGAAGTTCTTCTCAAAGGCGTCGGCTTCCCTGGATTGGAC
AACAACACCGGTGAGGTCGCGTCCCCGCTTCCATTCGGTGACACCTCGACTGGCGGCAACGACACCGGCATGATGCGCCTCCAGTCTGACTTCGCCCTTGCACGCGACGAGCGCACTGCT
TGCTTCTGGCAGGGCTTCGTCGACCAGCAGGACTTCATGGCACAGAGTTTCCAGGCTGCTTTCGAGAAGATGGCGATCCTCGGTAGCAACGCCGCGGACCTCATCAACTGCTCCGCTGTC
GTGCCCCAGTCTGTCGGCCCCGTCACCGTGCCCGCGACGTTCCCCGCGACGACCGGCCCCCAGGATCTCCAGCTTAACTGCACCTCTGAGACGTTCCCGTCGCTCAGCATTGACC
CGGGT
GCGACCGAGACCCTCATCCCGCACTGCCCCGATGGTACCGAGGACTGCCCGTCCGTCCAGTTCTCGGGCCCGGCCACCGACTCGCCCTGA

Retrieve as FASTA