Entry information : PcMnP01-1A_RP78 (MnP4 / PcMnP01a_RP78)
Entry ID 2379
Creation 2006-08-31 (Christophe Dunand)
Last sequence changes 2011-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2018-05-30 (Catherine Mathe)
Peroxidase information: PcMnP01-1A_RP78 (MnP4 / PcMnP01a_RP78)
Name (synonym) PcMnP01-1A_RP78 (MnP4 / PcMnP01a_RP78)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP01-1A_RP78
start..stop
S start..stop
PcMnP01_OGC101 766 0 1..378 1..378
PcMnP01-1B_RP78 764 0 1..378 1..378
PsoMnP02 663 0 1..378 1..377
PcMnP05 654 0 1..378 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 846535..846654 120 N° 2 846715..846766 52 N° 3 846823..846889 67 N° 4 846953..847130 178
N° 5 847203..847424 222 N° 6 847494..847908 415 N° 7 847967..848049 83  
join(846535..846654,846715..846766,846823..846889,846953..847130,847203..847424, 847494..847908,847967..848049)


exon

Literature and cross-references PcMnP01-1A_RP78 (MnP4 / PcMnP01a_RP78)
Literature Macarena,S., Fernando,L.L., Monica,V., Rafael,V. and Bernardo,G. Incomplete processing of peroxidase transcripts in the lignin degrading fungus Phanerochaete chrysosporium. FEMS Microbiol. Lett. 242 (1), 37-44 (2005)
Protein ref. UniProtKB:   Q02567
DNA ref. JGI genome:   scaffold_15 (846535..848049)
mRNA ref. GenBank:   AY442337
Protein sequence: PcMnP01-1A_RP78 (MnP4 / PcMnP01a_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39460.47 (37629.4)  
PI (pH):   %s   4.56 (4.43) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKSLIAFVALAAAVRAAPTAVCPDGTRVSHAACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFMQKHNTISAADLVQFAGAVALSNCGAPRLEFLAGRPNKTIAAVDGLIPEPQDSVTKILQRFEDAGGFTPFEVVSLLASHSVARADKVDQTIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGSANNTGEVASPLPLGSGSDTGEMRLQSDFALAHDPRTACIWQGFVNEQAFMAASFRAAMSKLAVLGHNRNSLIDCSDVVPVPKPATGQPAMFPASTGPQDLELSCPSERFPTLTTQPGASQSLIAHCPDGSMSCPGVQFNGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic and mRNA. Strain="BKM1767". The contig contains two similar MnP01 => named MnP01a and MnP01b.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGTCCCTCATCGCCTTCGTCGCCCTCGCGGCCGCTGTTCGTGCTGCCCCGACGGCGGTGTGCCCCGACGGCACCCGCGTCAGCCACGCGGCGTGCTGCGCTTTCATCCCT
GTAAGCAGGCGGCGCTCGCAGTAGTTGGGCTTCCAAGTCCTGACACTGGCATGTCCCTAGCTCGCGCAGGATCTGCAAGAGACCATCTTCCAGAATGAGTGCGGTGAAGACGGTCAGTGT
CGTCTACTAGCCCTGCCAGGCGCCGCCGAGACTCATCGTGTTTCGCAGCCCACGAGGTCATTCGCCTGACGTTCCACGACGCCATCGCCATCTCTCGCTCCCAGGGCCCCAAGGCGTGAG
TCTCGTGACGGCCGAGCTCGTTCATCGTTCTGTGTCCTGACAGCAGCTGTGTTTCCAGCGGCGGCGGTGCCGACGGCTCGATGCTCCTGTTCCCGACGGTCGAGCCCAACTTCTCGGCCA
ACAACGGCATCGACGACTCGGTCAACAACCTGATACCGTTCATGCAGAAGCACAACACGATCAGCGCCGCCGACCTCGTCCAGTTCGCGGGTGCCGTCGCGCTCAGCAACTGCCCC
GTAA
GCAGTCTTTCAATGCCTCGGCTTGCGCGCGACAGTCGTTTCTGACCAGTGACCACGCCTGTGGGGCAGGGTGCACCCCGGCTCGAGTTCCTGGCGGGCCGCCCGAACAAGACGATCGCTG
CCGTCGACGGACTGATCCCCGAGCCGCAGGACAGCGTGACCAAGATCCTGCAGCGTTTCGAGGACGCCGGTGGCTTCACGCCCTTCGAGGTCGTCTCTCTGCTGGCCTCGCACTCTGTCG
CGCGCGCGGACAAGGTCGACCAGACGATCGACGCTGCGCCCTTTGACTCG
GTCAGTGACTGCCCGTGTTGTTGAGTTACGCCAGACACGGCTAACGGGCAAGTCCCTCCCTCTCCCCAGA
CTCCGTTCACGTTCGACACGCAGGTGTTCCTCGAGGTGCTGCTCAAGGGCGTCGGCTTCCCGGGCTCCGCGAACAACACGGGCGAGGTGGCGTCGCCGCTCCCGCTCGGCAGCGGCAGCG
ACACGGGCGAGATGCGGCTGCAGTCCGACTTTGCGCTCGCGCACGACCCGCGCACGGCGTGCATCTGGCAGGGCTTCGTGAACGAGCAGGCGTTCATGGCCGCGAGCTTCAGGGCGGCGA
TGAGCAAGCTCGCTGTGCTCGGGCACAACCGCAACAGCCTGATCGACTGCAGCGACGTCGTCCCCGTGCCGAAGCCCGCGACTGGCCAGCCCGCGATGTTCCCGGCGTCGACTGGCCCGC
AGGACCTGGAGCTGTCGTGCCCCTCGGAGCGCTTCCCGACTCTGACTACCCAGC
GTACGTCCCTCTGGATTTGTCCAGTTGCCCTATCGCTGATCAGTTCGGTGCACTGAAGCGGGCGCG
TCGCAGTCGCTGATCGCGCACTGCCCCGACGGCAGCATGTCCTGCCCCGGTGTCCAGTTCAACGGCCCTGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGTCCCTCATCGCCTTCGTCGCCCTCGCGGCCGCTGTTCGTGCTGCCCCGACGGCGGTGTGCCCCGACGGCACCCGCGTCAGCCACGCGGCGTGCTGCGCTTTCATCCCT
CTCGCGCAGGATCTGCAAGAGACCATCTTCCAGAATGAGTGCGGTGAAGACGCCCACGAGGTCATTCGCCTGACGTTCCACGACGCCATCGCCATCTCTCGCTCCCAGGGCCCCAAGGCC
GGCGGCGGTGCCGACGGCTCGATGCTCCTGTTCCCGACGGTCGAGCCCAACTTCTCGGCCAACAACGGCATCGACGACTCGGTCAACAACCTGATACCGTTCATGCAGAAGCACAACACG
ATCAGCGCCGCCGACCTCGTCCAGTTCGCGGGTGCCGTCGCGCTCAGCAACTGCCCC
GGTGCACCCCGGCTCGAGTTCCTGGCGGGCCGCCCGAACAAGACGATCGCTGCCGTCGACGGA
CTGATCCCCGAGCCGCAGGACAGCGTGACCAAGATCCTGCAGCGTTTCGAGGACGCCGGTGGCTTCACGCCCTTCGAGGTCGTCTCTCTGCTGGCCTCGCACTCTGTCGCGCGCGCGGAC
AAGGTCGACCAGACGATCGACGCTGCGCCCTTTGACTCG
ACTCCGTTCACGTTCGACACGCAGGTGTTCCTCGAGGTGCTGCTCAAGGGCGTCGGCTTCCCGGGCTCCGCGAACAACACG
GGCGAGGTGGCGTCGCCGCTCCCGCTCGGCAGCGGCAGCGACACGGGCGAGATGCGGCTGCAGTCCGACTTTGCGCTCGCGCACGACCCGCGCACGGCGTGCATCTGGCAGGGCTTCGTG
AACGAGCAGGCGTTCATGGCCGCGAGCTTCAGGGCGGCGATGAGCAAGCTCGCTGTGCTCGGGCACAACCGCAACAGCCTGATCGACTGCAGCGACGTCGTCCCCGTGCCGAAGCCCGCG
ACTGGCCAGCCCGCGATGTTCCCGGCGTCGACTGGCCCGCAGGACCTGGAGCTGTCGTGCCCCTCGGAGCGCTTCCCGACTCTGACTACCCAGC
CGGGCGCGTCGCAGTCGCTGATCGCG
CACTGCCCCGACGGCAGCATGTCCTGCCCCGGTGTCCAGTTCAACGGCCCTGCATAA

Retrieve as FASTA