1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Entry ID 238
Creation 2006-02-07 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Name (synonym) AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Flowers
Mixed tissues
Pericycle cells (roots)
Roots
Seedlings
Siliques
Inducer Cold stress
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx72
start..stop		 S start..stop
AlyPrx72 685 0 1..336 1..336
AhalPrx01 683 0 1..336 1..336
NoffPrx72-1B 673 0 1..336 1..336
NoffPrx72-1A 671 0 1..336 1..336
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Literature Fernández-Pérez F, Pomar F, Pedreño MA, Novo-Uzal E. Suppression of Arabidopsis peroxidase 72 alters cell wall and phenylpropanoid metabolism.Plant Sci. 2015 Oct;239:192-9
Protein ref. UniProtKB:   Q9FJZ9
DNA ref. Phytozome 12:   Chr5 (26517329..26516063)
mRNA ref. GenBank:   NM_126037
Cluster/Prediction ref. Phytozome Gene 12:   19667215 UniGene:   At.25460
Omic ref. AtProteome:   At5g66390 ATTED-II:   At5g66390 e-FP Browser:   At5g66390 ePlant:   At5g66390 Genevestigator:   At5g66390 TAIR:   At5g66390
Protein sequence: AtPrx72 (At5g66390 / PER72 / AtperoxP72 / PRXR8 / ATP6 / Atprxr8ge)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (313)
PWM (Da):   %s   37239.82 (34819.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.54 (8.55) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSLNILIAALSLIAFSPFCLCSKAYGSGGYLFPQFYDQSCPKA
QEIVQSIVAKAFEHDPRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQECPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTILTKFKRQGLDLVDLVSLSG
SHTIGNSRCTSFRQRLYNQSGNGKPDMTLSQYYATLLRQRCPRSGGDQTLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNKQSKELVELYAENQEAFFEQFAKSMVKMGNISPL
TGAKGEIRRICRRVNHAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 6 cDNA and 29 ESTs.
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST