1. Browse the Database
  2. View Redoxidase
Entry information : PcMnP02_RP78 (MP-1)
Entry ID 2383
Creation 2007-12-26 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-23 (Christophe Dunand)
Peroxidase information: PcMnP02_RP78 (MP-1)
Name (synonym) PcMnP02_RP78 (MP-1)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP02_RP78
start..stop		 S start..stop
PcMnP02_OGC101 772 0 1..382 1..382
PcMnP05 692 0 1..382 1..381
PsoMnP02 669 0 1..382 1..377
PbreMnP04 646 0 1..382 1..380
Gene structure Fichier Exons►


exon

Literature and cross-references PcMnP02_RP78 (MP-1)
Literature Pease E.A., Andrawis A., Tien M. Manganese-dependent peroxidase from Phanerochaete chrysosporium. Primary structure deduced from cDNA sequence. J. Biol. Chem. 264:13531-13535(1989).
Protein ref. UniProtKB:   P19136  A7U4R1 [Fragment]
DNA ref. JGI genome:   scaffold_5 (506005..507526)
mRNA ref. GenBank:   J04980
Protein sequence: PcMnP02_RP78 (MP-1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (364)
PWM (Da):   %s   40018.64 (38214.6)  
PI (pH):   %s   4.32 (4.28) Peptide Signal:   %s   cut: 19 range:19-382
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFGSLLAFVALAAITRAAPTAESAVCPDGTRVTNAACCAFIPLAQDLQETLFQGDCGEDAHEVIRLTFHDAIAISQSLGPQAGGGADGSMLHFPTIEPNFSANSGIDDSVNNLLPFMQKHDTISAADLVQFAGAVALSNCGAPRLEFMAGRPNTTIPAVEGL
IPEPQDSVTKILQRFEDAGNFSPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGSNNNTGEVMSPLPLGSGSDTGEMRLQSDFALARDERTACFWQSFVN
EQEFMAASFKAAMAKLAILGHSRSSLIDCSDVVPVPKPAVNKPATFPATKGPKDLDTLTCKALKFPTLTSDPGATETLIPHCSNGGMSCPGVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from mRNA. Strain="ATCC 24725 / CBS 481.73 / CCRC 36200 / NRRL 6361 / VKM-F-1767", "RP78" and "FPL5157".
Peroxidase manganese-dependent H4 [Precursor]
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST