Entry information : PcMnP03_OGC101 (MNP3)
Entry ID 2385
Creation 2006-07-05 (Christophe Dunand)
Last sequence changes 2011-11-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-29 (Christophe Dunand)
Peroxidase information: PcMnP03_OGC101 (MNP3)
Name (synonym) PcMnP03_OGC101 (MNP3)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP03_OGC101
start..stop
S start..stop
PcMnP03_RP78 767 0 1..382 1..382
PcMnP03_ATCC24725 710 0 1..382 1..380
PcarMnP03 645 0 1..382 1..382
PgigMnP05 644 0 1..382 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1193..1324 132 N° 2 1376..1454 79 N° 3 1506..1545 40 N° 4 1607..1784 178
N° 5 1843..2064 222 N° 6 2115..2529 415 N° 7 2589..2671 83  
join(1193..1324,1376..1454,1506..1545,1607..1784,1843..2064,2115..2529,2589..267 1)


exon

Literature and cross-references PcMnP03_OGC101 (MNP3)
Literature Alic,M., Akileswaran,L. and Gold,M.H. Characterization of the gene encoding manganese peroxidase isozyme 3 from Phanerochaete chrysosporium. Biochim. Biophys. Acta 1338 (1), 1-7 (1997)
Protein ref. UniProtKB:   Q1K9D0
DNA ref. GenBank:   U70998
Protein sequence: PcMnP03_OGC101 (MNP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (363)
PWM (Da):   %s   39755.62 (37967.6)  
PI (pH):   %s   4.16 (4.16) Peptide Signal:   %s   cut: 20 range:20-382
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASSLLALVALAAVTSAAPATTQATCPDGTKVNNAACCAFIPLAQDLQETIFQNDCGEDAHEVIRLTFHDAIAISQSKGPSAGGGADGSMLLFPTIEPNFSANNGIDDSVNNLIPFMQKHDTISAGDIVQFAGAVALTNCGAPQLEFLAGRPNKTIPAIDGLIPEPQDSVTSILERFKDAGNFSPFEVVSLLASHSVARADKVDETIDAAPFDTTPFVFDTQIFLEVLLKGVGFPGTANNTGEVASPLPLTSGSDTGELRLQSDFALARDERTACIWQGFVNEQALMAASFKAAMAKLAVLGHDRNTLVDCSDVVPAPKPAVNKPASFPATTGPQDLELSCNTKPFPSLSVDAGAQQTLIPHCSDGDMTCQSVQFNGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Strain="OGC101".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCATCCTCACTCCTCGCTCTGGTGGCTCTTGCCGCAGTCACATCCGCTGCGCCGGCCACGACCCAGGCCACTTGCCCCGACGGTACCAAGGTCAACAACGCTGCCTGCTGC
GCTTTCATACCT
GTAAGCGGCCTTTCACTCGTCGAAAATGATCTTTACTTATCATTTCTACAGCTTGCACAGGATCTTCAGGAGACTATCTTCCAGAACGACTGCGGTGAAGACGCACAT
GAAGTTATTCGCCTTACTTTCC
GTAAGCCGAACGCAAATTGCGCAAATGCCATGCTAATCTTTTCCCTTGTAGACGACGCTATTGCCATTTCGCAAAGCAAGGGACCGAGCGCGTAAGCT
TATGCCCGATCTTGCGAGGCATTTCGAGTTCTGACTGGGGTTTCCCTTGACCAGTGGCGGCGGAGCTGACGGCTCCATGCTGCTGTTCCCCACCATTGAGCCCAACTTCTCTGCCAACAA
CGGTATCGATGACTCGGTCAACAATCTCATCCCGTTCATGCAAAAGCACGACACCATCAGCGCTGGCGACATCGTCCAGTTCGCCGGCGCCGTCGCGCTCACCAACTGTCCT
GTACGTCC
CTCTCACTCCGACTTCATCGGCGTAAGTCTGACGAATGATATGTATGTAGGGTGCGCCGCAGCTCGAGTTCCTTGCGGGACGCCCGAATAAGACAATCCCTGCCATTGATGGCCTCATTC
CCGAGCCGCAGGACAGCGTGACGTCGATCCTGGAGCGCTTCAAGGACGCAGGCAACTTCAGCCCGTTTGAGGTGGTCTCGCTGCTCGCGTCCCACTCCGTTGCGCGCGCAGACAAGGTAG
ACGAGACCATCGATGCCGCGCCGTTCGATACG
GTGAGCGCATCCCGCATACAGCCGCTATGCGTGCGCTGACTCTCGCGCAGACGCCGTTCGTGTTCGACACGCAGATCTTCCTCGAGGT
ACTCCTCAAGGGCGTCGGCTTCCCGGGGACGGCGAACAACACGGGTGAGGTCGCGTCGCCGCTGCCGCTGACGTCGGGCAGCGACACGGGCGAGCTGCGGCTGCAGTCCGACTTTGCGCT
CGCGCGCGACGAGCGGACGGCGTGCATCTGGCAGGGCTTCGTCAACGAGCAGGCGCTCATGGCCGCGAGCTTCAAGGCCGCCATGGCGAAGCTCGCCGTGCTCGGGCACGACCGCAACAC
GCTCGTCGACTGCAGCGACGTCGTGCCCGCGCCGAAGCCCGCCGTGAACAAGCCCGCGAGCTTCCCCGCCACCACGGGCCCCCAGGACCTCGAGCTCTCGTGCAACACGAAGCCGTTCCC
GTCGCTCTCTGTTGATG
GTGTGTCTGACCTTTCTCTGGTGGTGTTGTCGGCCGGCTGATGGGTTTTGCTTTTCCAGCGGGCGCGCAGCAGACGCTTATCCCGCACTGCTCCGACGGCGAC
ATGACGTGCCAGAGCGTCCAGTTCAACGGCCCTGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTGCATCCTCACTCCTCGCTCTGGTGGCTCTTGCCGCAGTCACATCCGCTGCGCCGGCCACGACCCAGGCCACTTGCCCCGACGGTACCAAGGTCAACAACGCTGCCTGCTGC
GCTTTCATACCT
CTTGCACAGGATCTTCAGGAGACTATCTTCCAGAACGACTGCGGTGAAGACGCACATGAAGTTATTCGCCTTACTTTCCACGACGCTATTGCCATTTCGCAAAGCAAG
GGACCGAGCGC
TGGCGGCGGAGCTGACGGCTCCATGCTGCTGTTCCCCACCATTGAGCCCAACTTCTCTGCCAACAACGGTATCGATGACTCGGTCAACAATCTCATCCCGTTCATGCAA
AAGCACGACACCATCAGCGCTGGCGACATCGTCCAGTTCGCCGGCGCCGTCGCGCTCACCAACTGTCCT
GGTGCGCCGCAGCTCGAGTTCCTTGCGGGACGCCCGAATAAGACAATCCCT
GCCATTGATGGCCTCATTCCCGAGCCGCAGGACAGCGTGACGTCGATCCTGGAGCGCTTCAAGGACGCAGGCAACTTCAGCCCGTTTGAGGTGGTCTCGCTGCTCGCGTCCCACTCCGTT
GCGCGCGCAGACAAGGTAGACGAGACCATCGATGCCGCGCCGTTCGATACG
ACGCCGTTCGTGTTCGACACGCAGATCTTCCTCGAGGTACTCCTCAAGGGCGTCGGCTTCCCGGGGACG
GCGAACAACACGGGTGAGGTCGCGTCGCCGCTGCCGCTGACGTCGGGCAGCGACACGGGCGAGCTGCGGCTGCAGTCCGACTTTGCGCTCGCGCGCGACGAGCGGACGGCGTGCATCTGG
CAGGGCTTCGTCAACGAGCAGGCGCTCATGGCCGCGAGCTTCAAGGCCGCCATGGCGAAGCTCGCCGTGCTCGGGCACGACCGCAACACGCTCGTCGACTGCAGCGACGTCGTGCCCGCG
CCGAAGCCCGCCGTGAACAAGCCCGCGAGCTTCCCCGCCACCACGGGCCCCCAGGACCTCGAGCTCTCGTGCAACACGAAGCCGTTCCCGTCGCTCTCTGTTGATG
CGGGCGCGCAGCAG
ACGCTTATCCCGCACTGCTCCGACGGCGACATGACGTGCCAGAGCGTCCAGTTCAACGGCCCTGCATAA

Retrieve as FASTA