1. Browse the Database
  2. View Redoxidase
Entry information : AtPrx73 (At5g67400 / PER73 / AtperoxP73 / PRXR11 / ATP10a / AtP10 / Atprxr11g / RHS19)
Entry ID 239
Creation 2006-02-07 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-04 (Achraf Jemmat)
Peroxidase information: AtPrx73 (At5g67400 / PER73 / AtperoxP73 / PRXR11 / ATP10a / AtP10 / Atprxr11g / RHS19)
Name (synonym) AtPrx73 (At5g67400 / PER73 / AtperoxP73 / PRXR11 / ATP10a / AtP10 / Atprxr11g / RHS19)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx73
start..stop		 S start..stop
CagraPrx64 633 0 1..329 1..329
CrubPrx63 631 0 1..329 1..329
BstrPrx21 631 0 1..329 1..329
AlyPrx73 629 0 1..329 1..329
Gene structure Fichier Exons►


exon

Literature and cross-references AtPrx73 (At5g67400 / PER73 / AtperoxP73 / PRXR11 / ATP10a / AtP10 / Atprxr11g / RHS19)
Protein ref. UniProtKB:   Q43873
DNA ref. Phytozome 12:   Chr5 (26894896..26896300)
mRNA ref. GenBank:   NM_126140
Cluster/Prediction ref. Phytozome Gene 12:   19672175 UniGene:   At.95
Omic ref. AtProteome:   At5g67400 ATTED-II:   At5g67400 e-FP Browser:   At5g67400 ePlant:   At5g67400 Genevestigator:   At5g67400 TAIR:   At5g67400
Protein sequence: AtPrx73 (At5g67400 / PER73 / AtperoxP73 / PRXR11 / ATP10a / AtP10 / Atprxr11g / RHS19)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (304)
PWM (Da):   %s   35790.57 (33139.2)  
PI (pH):   %s   9.93 (9.93) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARFSLVVVVTLSLAISMFPDTTTAQLKTNFYGNSCPNVEQIVKK
VVQEKIKQTFVTIPATLRLFFHDCFVNGCDASVMIQSTPTNKAEKDHPDNISLAGDGFDVVIKAKKALDAIPSCKNKVSCADILALATRDVVVAAKGPSYAVELGRFDGLVSTAASVNGNLPGPNNKVTELNKLFAKNKLTQEDMIA
LSAAHTLGFAHCGKVFNRIYNFNLTHAVDPTLNKAYAKELQLACPKTVDPRIAINMDPTTPRQFDNIYFKNLQQGKGLFTSDQVLFTDGRSKPTVNDWAKNSVAFNKAFVTAMTKLGRVG
VKTRRNGNIRRDCGAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 4 cDNA and 11 ESTs (10 only in roots)
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST