Entry information : PoVP02_Florida (mnp2)
Entry ID 2392
Creation 2006-08-31 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-17 (Christophe Dunand)
Peroxidase information: PoVP02_Florida (mnp2)
Name (synonym) PoVP02_Florida (mnp2)
Class Versatile peroxidase    [Orthogroup: VP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP02_Florida
start..stop
S start..stop
PoVP02_PC9 735 0 1..364 1..364
PoVP02_PC15 735 0 1..364 1..364
PerVP02 653 0 1..351 1..357
PoVP05_PC9 523 0 1..364 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 630..687 58 N° 2 743..876 134 N° 3 931..992 62 N° 4 1046..1195 150
N° 5 1252..1373 122 N° 6 1421..1496 76 N° 7 1551..1587 37 N° 8 1644..1651 8
N° 9 1703..1783 81 N° 10 1837..1906 70 N° 11 1961..1970 10 N° 12 2021..2056 36
N° 13 2117..2293 177 N° 14 2353..2388 36 N° 15 2447..2471 25 N° 16 2525..2537 13
join(630..687,743..876,931..992,1046..1195,1252..1373,1421..1496,1551..1587,1644 ..1651,1703..1783,1837..1906,1961..1970,2021..2056,2117..2293,2353..2388,2447..2 471,2525..2537)


exon

Literature and cross-references PoVP02_Florida (mnp2)
Literature REFERENCE 1 Giardina P., Palmieri G., Fontanella B., Rivieccio V., Sannia G. Manganese peroxidase isoenzymes produced by Pleurotus ostreatus grown on wood sawdust. Arch. Biochem. Biophys. 376:171-179(2000).
Protein ref. UniProtKB:   Q9UVY8   Q96V55 [Other strain]
DNA ref. GenBank:   AJ243977
Protein sequence: PoVP02_Florida (mnp2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (344)
PWM (Da):   %s   38190.07 (36292.0)  
PI (pH):   %s   4.29 (4.24) Peptide Signal:   %s   cut: 21 range:21-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAKLSALVLALGATVALGAPSLNKRVTCATGQTTANEACCALFPILEDIQTNLFDGAQCGEVHESLRLTFHDAIAFSPALTNAGQFGGGGADGSMIIFSDTEPNFHANLGIDEIVEAQKPFIARHNISAADFIQFAGAIGVTNCAGAPRLNFFLGRPDATQIPPDGLVPEPDSVDKILSRMGDAGFSTVEVVWLLSSHTIAAADLVDPIPGTPFDSTPSTFDSQFFLETMLQGTAFPGTPGNQGEVESPLAGEMRLQSDFLARDSRSACEWQSMVNNMPKIQNRFTQVMRKLSLLGHNQADLIDCSDVIPVPKTLTKAATFPAGKSQADVEIVVAATPFPALASDPGPVTAVPPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns). mRNA accession gives a slightly different sequence (aigvSncag instead of aigvTncag). The authors of the mRNA sequencing (Cohen et al., Environ. Microbiol. 2001, p.312) write that their mRNA sequence is truly mnp2. Strain="Florida 6".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTAAACTTTCCGCTCTCGTCTTGGCTCTTGGTGCTACTGTCGCGCTTGGTGAATTACCAACCCATCTCGGGTGGAACACTGCCAGACTAATCGTTTTCAACAGGCGCACC
TAGTCTTAACAAACGCGTCACTTGTGCCACTGGCCAAACGACCGCCAACGAGGCTTGCTGCGCCCTGTTCCCGATTCTAGAGGACATACAGACCAACCTCTTTGACGGTGCCCAATGTGG
TGAAGAG
GTAGATTCCTCTTCGTATTTGTATACCTGGCCGCTAACGCATAGTAATGTCCAGGTGCACGAGTCCCTGCGCTTGACATTCCACGACGCGATTGCATTCTCCCCAGCATTGAC
CAA
GTAACGTCAACCGGTTTGATTATTGCGCCACGTGTGCTCACAGTTATCTTCAGCGCTGGCCAGTTCGGAGGCGGTGGTGCGGATGGTTCTATGATCATCTTCAGTGACACCGAGCCC
AATTTCCATGCCAACCTGGGCATCGATGAAATTGTTGAAGCACAGAAGCCGTTTATCGCTCGTCACAACATCAGTGCTGCCGACTT
GTGCGTCGCGACACTTTCCCTCGTCATAAGAATT
AGCACTCAAAATTATCTTCTAGCATTCAATTCGCTGGTGCCATCGGCGTCACGAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCCTGGGTCGTCCCGATGCCACCCAGATTCCACCTG
ATGGTCTTGTCCCAGAGCCTTTCG
GTATTACCTTTAACCTATACTACGTCGTCAACTCATTTGGCCTTCAGATAGCGTGGATAAGATTCTTAGCAGGATGGGTGACGCTGGATTCAGCAC
CGTTGAAGTCGTCTGGCTGCTTTCCTC
GTAAGCTATCTTCGGCATCTATCCACCTTCTAGAAATCAATGATATCTCGACAGCCACACTATCGCTGCAGCCGATCTTGTTGACCCCTCCGT
AAGTGACCCTTTGCCAAGCTCGATGTTTTCGCTAGTTGACCTCATTGTACATAGATTCCTGGGTACAGGTGTTCTCCCTCGTGACATATTCCCCACTAATAATAAATCCTTAGAACTCCC
TTCGACTCAACTCCATCTACGTTCGACTCTCAATTCTTCCTGGAGACAATGTTGCAAGGGACCGCCTTCCCAGG
GTAACTGTTCATCGCTGATGCTGTCGGGATCGTAGTGCTAACTTGA
AGTTCAGAACCCCAGGCAACCAGGGTGAAGTTGAGTCGCCTCTCGCAGGTGAAATGAGACTCCAATCCGACTTCTTGGTATGTTACTCTAGACCGATGCAGAGCCACAGTTCTGATACCT
CTCCCGTATAGCTTGCCCGAGGTAATATTCATATCGCTTAGTCAGATACATCCACTAAACATCAATCACAGACTCCAGGAGTGCCTGTGAATGGCAGTCCATGGTCAGTAAGTACTACGT
TCCCGTGTCTATATTTGATCGTTGTGGGATCTAATAAAACGACTTAGACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAGGAAGCTTTCTCTCCTCGGTCACAACCAGGC
TGATCTCATCGACTGCTCTGATGTTATTCCTGTTCCCAAGACGCTCACCAAGGCCGCCACCTTCCCCGCTGGCAAGAGTCAGGCTGATGTCGAGATCGTGGTAG
GTCTTATCGCGTATTG
CAAAATAATTGTTACCCACTACTCTCCGTACAGTGCAATGCAGCTGCTACACCCTTCCCAGCTCTCGCCAGCGACCCCGGTAAGTTCCTTCAGTTTTCAACCAGTCTTTGCATAGCTAAC
TGGCTTCGGTTCTATAGGCCCAGTCACCGCCGTTCCTCCCGTGTACGCCCCACATCTCGCTCTTCACTTATTCAACAAGCTAACATATTGTGCAGCCCACCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTAAACTTTCCGCTCTCGTCTTGGCTCTTGGTGCTACTGTCGCGCTTGGCGCACCTAGTCTTAACAAACGCGTCACTTGTGCCACTGGCCAAACGACCGCCAACGAGGCT
TGCTGCGCCCTGTTCCCGATTCTAGAGGACATACAGACCAACCTCTTTGACGGTGCCCAATGTGGTGAAGAG
GTGCACGAGTCCCTGCGCTTGACATTCCACGACGCGATTGCATTCTCC
CCAGCATTGACCAA
CGCTGGCCAGTTCGGAGGCGGTGGTGCGGATGGTTCTATGATCATCTTCAGTGACACCGAGCCCAATTTCCATGCCAACCTGGGCATCGATGAAATTGTTGAAGCA
CAGAAGCCGTTTATCGCTCGTCACAACATCAGTGCTGCCGACTT
CATTCAATTCGCTGGTGCCATCGGCGTCACGAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCCTGGGTCGTCCC
GATGCCACCCAGATTCCACCTGATGGTCTTGTCCCAGAGCCTTTCG
ATAGCGTGGATAAGATTCTTAGCAGGATGGGTGACGCTGGATTCAGCACCGTTGAAGTCGTCTGGCTGCTTTCC
TC
CCACACTATCGCTGCAGCCGATCTTGTTGACCCCTCCATTCCTGGAACTCCCTTCGACTCAACTCCATCTACGTTCGACTCTCAATTCTTCCTGGAGACAATGTTGCAAGGGACCGCC
TTCCCAGG
AACCCCAGGCAACCAGGGTGAAGTTGAGTCGCCTCTCGCAGGTGAAATGAGACTCCAATCCGACTTCTTGCTTGCCCGAGACTCCAGGAGTGCCTGTGAATGGCAGTCCATG
GTCA
ACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAGGAAGCTTTCTCTCCTCGGTCACAACCAGGCTGATCTCATCGACTGCTCTGATGTTATTCCTGTTCCCAAGACG
CTCACCAAGGCCGCCACCTTCCCCGCTGGCAAGAGTCAGGCTGATGTCGAGATCGTGGTAG
CTGCTACACCCTTCCCAGCTCTCGCCAGCGACCCCGGCCCAGTCACCGCCGTTCCTCCC
GT
CCCACCTTCGTAA

Retrieve as FASTA