Entry information : PoVP01_IFO30160 (mnp1)
Entry ID 2393
Creation 2006-08-31 (Christophe Dunand)
Last sequence changes 2011-11-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-25 (Christophe Dunand)
Peroxidase information: PoVP01_IFO30160 (mnp1)
Name (synonym) PoVP01_IFO30160 (mnp1)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP01_IFO30160
start..stop
S start..stop
PoVP01_PC15 731 0 1..361 1..361
PoVP01_PC9 725 0 1..358 1..358
PpulVP01 706 0 1..361 1..362
PoVP03_PC9 575 0 1..348 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 391..454 64 N° 2 506..639 134 N° 3 690..748 59 N° 4 803..940 138
N° 5 998..1119 122 N° 6 1171..1246 76 N° 7 1297..1333 37 N° 8 1388..1395 8
N° 9 1447..1527 81 N° 10 1583..1652 70 N° 11 1722..1731 10 N° 12 1791..1826 36
N° 13 1888..2060 173 N° 14 2119..2158 40 N° 15 2217..2241 25 N° 16 2295..2307 13
join(391..454,506..639,690..748,803..940,998..1119,1171..1246,1297..1333,1388..1 395,1447..1527,1583..1652,1722..1731,1791..1826,1888..2060,2119..2158,2217..2241 ,2295..2307)


exon

Literature and cross-references PoVP01_IFO30160 (mnp1)
Literature Asada Y., Watanabe A., Irie T., Nakayama T., Kuwahara M. Structures of genomic and complementary DNAs coding for Pleurotus ostreatus manganese (II) peroxidase. Biochim. Biophys. Acta 1251:205-209(1995).
Protein ref. UniProtKB:   Q12332
DNA ref. GenBank:   U21878
mRNA ref. GenBank:   U21879
Protein sequence: PoVP01_IFO30160 (mnp1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (339)
PWM (Da):   %s   38119.9 (35872.7)  
PI (pH):   %s   4.44 (4.44) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFASLSALVLVFAVTVQVAQAVSLPQKRATCAGGQVTANAACCVLFPLMEDLQKNLFDDGACGEAHEALRLTFHDAIGFSPSRGVMGGADGSVITFSDTEVNFPANLGIDEIVEAEKPFLARHNISAGDLVHFAGTLAVTNCPGAPRIPFFLGRPPAKAASPIGLVPEPDTITDILARMDDAGFVSVEVVWLLSAHSVAAADHVDEIPGTPFDSTPNLFDSQIFIETQLRGISFPGTGGNHGEVQSPLKGEMRLQSDHFARDDRTSCEWQSMTNDQQKIQDRFSDTLFKMSMLGQNQDAMIDCSDVIPVPAALVTKPHLPAGKSKTDVEQCATGAFPALGADPGPVTSVPRVPPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns) and mRNA. Strain="IFO 30160".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTTGCTTCGCTTTCTGCGCTCGTCCTTGTCTTCGCTGTGACTGTCCAAGTCGCTCAAGGTGAGCCACCGCGTCCCCTCCTACTGATTAGCCTAACACGACGTGCTTCAGCCGTA
TCTTTGCCTCAGAAACGCGCAACTTGTGCTGGTGGACAAGTTACCGCCAACGCGGCCTGTTGTGTTCTGTTCCCGCTCATGGAAGACCTGCAGAAGAACCTGTTCGACGACGGCGCATGC
GGCGAAGAT
GTACGCTCGCTCCATCCACTACGACTCTTACTTATTGCTATCTATGCCAGGCCCATGAAGCCCTTCGCCTGACCTTCCACGACGCTATTGGATTCTCTCCTTCCAGGGGGT
AGGTCTTCGCCCATTTTGTATGGCGCCCCTGTTATTGATTTGTCGAGGACAGTGTTATGGGAGGCGCCGATGGCTCTGTCATCACATTCTCCGATACTGAGGTCAACTTCCCAGCCAACC
TCGGTATTGACGAGATCGTCGAGGCTGAGAAACCGTTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GTACGTTATTCACTGGCCTATTCAAGACTGAGGATTGACACTCACTACTT
TGCGCAGGGTTCACTTCGCCGGCACCCTCGCTGTTACCAACTGTCCTGGTGCTCCACGAATCCCGTTCTTCTTAGGTCGCCCTCCTGCCAAGGCCGCATCACCCATTGGATTGGTTCCGG
AACCATTCG
GTCAGCAGCTGTTTTGGGAATTTGCCGCAGACTGTTAACGACCTTGAATAGATACCATTACAGATATCCTGGCCCGAATGGATGACGCTGGATTCGTCTCTGTCGAGGTTG
TCTGGCTTCTTTCCGC
GTACGATAAACACCATTTGCTCCAGAACTCATGGCTGACGTAGCGTACAGCCACTCTGTCGCTGCAGCTGACCATGTTGACGAAACTGTAAGCATTACCCAAAG
ATTACGACGTTCGACGCTGACTTAACTTTTTGTGAAGATTCCTGGGTAAGCTTTGCATACAAATTTATTTTTCTCTTGTGGCTTACACGCACTCAGAACGCCGTTCGACTCAACGCCAAA
CCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGTGGAATTTCCTTCCCAGG
GTAGGGGGTTCTCCTAATGCCCAATCCACGTACATATTGCTCACTTGTTGAATAGCACTGGTG
GGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAAATGAGACTCCAGTCAGATCACTTG
GTTAGTCTTTACACTGCTCTCTTGCACGGAGAAGCGATATCTGACATGACGTGCCCAC
CGATTTGACAGTTCGCTCGAGGTACTTGAAACTAATCATTCATAATAACTCTCCCCCATTAAAACATCCAAATGTATCAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAGTAA
GTATCATGCTCTACCGCTTCCCTTTCTCCTCCTAAGCTCATTGTCAACGATAATTAGATGATCAACAGAAGATCCAAGACCGCTTTTCCGACACACTGTTCAAGATGTCGATGCTTGGAC
AGAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCTGTCCCCGCTGCCCTTGTAACCAAACCCCATCTCCCCGCCGGGAAGAGTAAGACCGACGTTGAACAAGCC
GTGCGTCGTG
CAATGTATCAGGGATAACTTAACGTCGCTGAATTGTTTTCCTCCCTAGTGTGCCACCGGCGCCTTCCCAGCCCTCGGTGCTGACCCTGGTGAGTAAACAGGCGACGTAGACAACAGAAAG
CCTCTTACCCATTGATTTTTCTTTAGGCCCAGTCACCTCTGTTCCTCGTGTGTAAGTGTCAACCTATGTCTCTATGAGTGCATTGATGCCAACGAACACCCTAGCCCACCTGCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTTTGCTTCGCTTTCTGCGCTCGTCCTTGTCTTCGCTGTGACTGTCCAAGTCGCTCAAGCCGTATCTTTGCCTCAGAAACGCGCAACTTGTGCTGGTGGACAAGTTACCGCCAAC
GCGGCCTGTTGTGTTCTGTTCCCGCTCATGGAAGACCTGCAGAAGAACCTGTTCGACGACGGCGCATGCGGCGAAGAT
GCCCATGAAGCCCTTCGCCTGACCTTCCACGACGCTATTGGA
TTCTCTCCTTCCAGGGG
TGTTATGGGAGGCGCCGATGGCTCTGTCATCACATTCTCCGATACTGAGGTCAACTTCCCAGCCAACCTCGGTATTGACGAGATCGTCGAGGCTGAGAAACCG
TTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GGTTCACTTCGCCGGCACCCTCGCTGTTACCAACTGTCCTGGTGCTCCACGAATCCCGTTCTTCTTAGGTCGCCCTCCTGCCAAG
GCCGCATCACCCATTGGATTGGTTCCGGAACCATTCG
ATACCATTACAGATATCCTGGCCCGAATGGATGACGCTGGATTCGTCTCTGTCGAGGTTGTCTGGCTTCTTTCCGCCCACTCT
GTCGCTGCAGCTGACCATGTTGACGAAACT
ATTCCTGGAACGCCGTTCGACTCAACGCCAAACCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGTGGAATTTCCTTCCCAGGC
ACTGGTGGGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAAATGAGACTCCAGTCAGATCACTTG
TTCGCTCGAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAATGAT
CAACAGAAGATCCAAGACCGCTTTTCCGACACACTGTTCAAGATGTCGATGCTTGGACAGAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCTGTCCCCGCTGCCCTTGTAACC
AAACCCCATCTCCCCGCCGGGAAGAGTAAGACCGACGTTGAACAAGCC
TGTGCCACCGGCGCCTTCCCAGCCCTCGGTGCTGACCCTGGCCCAGTCACCTCTGTTCCTCGTGTCCCACCT
GCGTAA

Retrieve as FASTA