1. Browse the Database
  2. View Redoxidase
Entry information : PcLiP05_RP78 (LiP2 / GLG2 / PcLiPE_RP78)
Entry ID 2409
Creation 2006-09-01 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-24 (Christophe Dunand)
Peroxidase information: PcLiP05_RP78 (LiP2 / GLG2 / PcLiPE_RP78)
Name (synonym) PcLiP05_RP78 (LiP2 / GLG2 / PcLiPE_RP78)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP05_RP78
start..stop		 S start..stop
PcLiP05_BKMF1767 754 0 1..371 1..371
PcLiP02_RP78 677 0 1..368 1..368
PcLiP07_RF78 645 0 1..368 1..368
PcLiP08_RP78 644 0 1..368 1..364
Gene structure Fichier Exons►


exon

Literature and cross-references PcLiP05_RP78 (LiP2 / GLG2 / PcLiPE_RP78)
Literature Ritch,T.G. Jr., Nipper,V.J., Akileswaran,L., Smith,A.J., Pribnow,D.G. and Gold,M.H. Lignin peroxidase from the basidiomycete Phanerochaete chrysosporium is synthesized as a preproenzyme Gene 107 (1), 119-126 (1991)
Protein ref. UniProtKB:   P49012
DNA ref. GenBank:   M92644 JGI genome:   scaffold_19 (360406..358861)
mRNA ref. GenBank:   M74229 JGI transcript:   11110
Protein sequence: PcLiP05_RP78 (LiP2 / GLG2 / PcLiPE_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (350)
PWM (Da):   %s   39233.21 (37100.1) Transmb domain:   %s   o260-282i
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 22 range:22-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLFAAITVALSLTAANAAVVKEKRATCANGKTVGDASCCAW
FDVLDDIQANMFHGGQCGAEAHESIRLVFHDSIAISPAMEAKGKFGGGGADGSIMIFDTIETAFHPNIGLDEVVAMQKPFVQKHGVTPGDFIAFAGAVALSNCPGAPQMNFFTGRKATQPAPDGLV
PEPFHTVDQIIARVNDAGEFDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQFRGTLFPGSGGNQGEVESGMAGEIRIQTDHTLARDSRTACEWQSFVGNQSKLVDD
FQFIFLALTQLGQDPNAMTDCSDVIPLSKPIPGNGPFSFFPPGKSHSDIEQCAETPFPSLVTLPGPATSVARIPPHKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and mRNA. No EST. Strain="RP78" and "OGC101" (a derivative of ME446, but with different properties (Alic et al., Appl Environ Microbiol, 1987)).
DNA ►
Send to BLAST
CDS►
Send to BLAST