Entry information : PcLiP02_RP78 (LPOB / Ligninase B / PcLiPB_RP78)
Entry ID 2413
Creation 2006-12-28 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-24 (Christophe Dunand)
Peroxidase information: PcLiP02_RP78 (LPOB / Ligninase B / PcLiPB_RP78)
Name (synonym) PcLiP02_RP78 (LPOB / Ligninase B / PcLiPB_RP78)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP02_RP78
start..stop
S start..stop
PcLiP05_BKMF1767 676 0 1..368 1..368
PcLiP05_RP78 673 0 1..368 1..368
PcLiP07_RF78 671 0 1..372 1..372
PsoLiP07 659 0 1..372 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 378234..378294 61 N° 2 378023..378176 154 N° 3 377914..377970 57 N° 4 377645..377859 215
N° 5 377550..377591 42 N° 6 377419..377497 79 N° 7 376945..377368 424 N° 8 376827..376891 65
N° 9 376752..376773 22  
complement(join(376752..376773,376827..376891,376945..377368,377419..377497,3775 50..377591,377645..377859,377914..377970,378023..378176,378234..378294))


exon

Literature and cross-references PcLiP02_RP78 (LPOB / Ligninase B / PcLiPB_RP78)
Literature Gaskell J., Dieperink E., Cullen D. Genomic organization of lignin peroxidase genes of Phanerochaete chrysosporium. Nucleic Acids Res. 19:599-603(1991).
Protein ref. UniProtKB:   P31837
DNA ref. GenBank:   M37701 JGI genome:   scaffold_19 (378294..376752)
mRNA ref. JGI transcript:   121822
Protein sequence: PcLiP02_RP78 (LPOB / Ligninase B / PcLiPB_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39341.33 (37226.2)  
PI (pH):   %s   4.2 (4.16) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLVAAISLALSLTTANAAVVKEKRATCSNGATVGDASCCAWFDVLDDIQQNLFQGGQCGAEAHESIRLVFHDAIAISPAMEAQGKFGGGGADGSIMIFDDIEPNFHPNIGLDEIINLQKPFVQKHGVTPGDFIAFAGAVALSNCPGAPQMNFFTGRAATQPAPDGLVPEPFHTVDQIIARVNDAGEFDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQFRGILFPGSGGNQGEVESGMAGEIRIQTDHTLARDSRTACEWQSFVNNQSKLVSDFQFIFLALTQLGQDPNAMTDCSDVIPISKPIPGNLPFSFFPPGKSMKDVEQCAETPFPSLVTLPGPATSVARIPPPPGA

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (8 introns). Cluster with PcLiPA. Strain="BKM-F-1767; ATCC24725" and "RP78".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCGTCGCAGCGATTTCCCTCGCACTCTCGCTCACCACTGCCAATGGTACGCACCGCTTCTGCATGCTGTGATAACGCGCCCCGACTAACGCCTCCGCTGCAGCC
GCCGTGGTCAAGGAGAAGCGCGCCACCTGCTCCAACGGCGCCACCGTTGGCGACGCGTCCTGCTGTGCTTGGTTCGATGTCCTCGACGACATCCAGCAGAACCTGTTCCAAGGAGGCCAG
TGCGGCGCTGAGGCCCACGAGTCTATCCGTCT
GTAAGTCAATACGCTGGTGTTGCGCCAAGGTCATAGATTCACTTTGCTGCAGCGTGTTCCACGATGCTATTGCCATCTCTCCTGCTAT
GGAGGCCCAGGGCAAGTTCGG
GTATGTCTTTCCGGCATGGCAATATTTTACAGCAGACACTGAGATATTGCGCAGCGGTGGTGGTGCTGACGGCTCCATCATGATCTTCGACGACATCGA
GCCCAACTTCCACCCTAACATTGGCCTCGACGAGATTATCAACCTCCAGAAGCCGTTCGTCCAGAAGCACGGTGTCACCCCTGGTGACTTCATCGCCTTCGCCGGTGCTGTCGCGCTCAG
CAACTGCCCGGGTGCCCCACAGATGAACTTCTTCACTGGTCGTGCTCCTG
GTACGTCTCCTCTACGAATGCATTCTGCACACCTCATTCATATCGCCTTATAGCTACCCAGCCCGCACCC
GATGGTCTCGTCCCCGAGCCTTTCC
GTGAGTTTGCAGACCACTTTCATCGCATAGTTCTTAGCTGACCTCAGCACAGACACCGTCGACCAGATCATCGCTCGTGTTAACGATGCCGGCGA
GTTCGACGAGCTCGAGCTTGTCTGGATGCTTTCCGC
GTAAGTGACTGCCGCCTCGAATTTCCATCCCGACTTACACCCCGATTCAGCCACTCCGTTGCTGCAGTCAACGACGTGGACCCG
ACCGTCCAGGGCCTGCCCTTCGACTCCACCCCCGGAATCTTCGACTCGCAGTTCTTCGTCGAGACTCAGTTCCGTGGTATCCTCTTCCCCGGCTCCGGTGGCAACCAGGGTGAGGTCGAG
TCCGGTATGGCTGGCGAGATCCGCATCCAGACCGACCACACTCTCGCCCGCGACTCCCGCACCGCTTGCGAGTGGCAGTCGTTCGTCAACAACCAGTCCAAGCTCGTCTCCGACTTCCAG
TTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCGGATGTCATCCCGATCTCGAAGCCCATCCCCGGCAACCTTCCGTTCTCGTTCTTCCCCCCT
GGCAAGAGCATGAAGGATGTTGAGCAGGCT
GTACGTATCCGATTCAGTCCTTGTCGCAGAGCTTATGCTGACGGCTTCTGCAGTGCGCCGAGACCCCCTTCCCCAGCCTCGTCACTCTCC
CCGGCCCCGCGACCTCTGTCGCTCGCAT
GTGAGTATCTCCGACGGTCTATGAAGCCCCCAGCTGACATATTCCTCTTCCAGCCCCCCGCCGCCGGGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCGTCGCAGCGATTTCCCTCGCACTCTCGCTCACCACTGCCAATGCCGCCGTGGTCAAGGAGAAGCGCGCCACCTGCTCCAACGGCGCCACCGTTGGCGACGCG
TCCTGCTGTGCTTGGTTCGATGTCCTCGACGACATCCAGCAGAACCTGTTCCAAGGAGGCCAGTGCGGCGCTGAGGCCCACGAGTCTATCCGTCT
CGTGTTCCACGATGCTATTGCCATC
TCTCCTGCTATGGAGGCCCAGGGCAAGTTCGG
CGGTGGTGGTGCTGACGGCTCCATCATGATCTTCGACGACATCGAGCCCAACTTCCACCCTAACATTGGCCTCGACGAGATTATCAAC
CTCCAGAAGCCGTTCGTCCAGAAGCACGGTGTCACCCCTGGTGACTTCATCGCCTTCGCCGGTGCTGTCGCGCTCAGCAACTGCCCGGGTGCCCCACAGATGAACTTCTTCACTGGTCGT
GCTCCTG
CTACCCAGCCCGCACCCGATGGTCTCGTCCCCGAGCCTTTCCACACCGTCGACCAGATCATCGCTCGTGTTAACGATGCCGGCGAGTTCGACGAGCTCGAGCTTGTCTGGATG
CTTTCCGC
CCACTCCGTTGCTGCAGTCAACGACGTGGACCCGACCGTCCAGGGCCTGCCCTTCGACTCCACCCCCGGAATCTTCGACTCGCAGTTCTTCGTCGAGACTCAGTTCCGTGGT
ATCCTCTTCCCCGGCTCCGGTGGCAACCAGGGTGAGGTCGAGTCCGGTATGGCTGGCGAGATCCGCATCCAGACCGACCACACTCTCGCCCGCGACTCCCGCACCGCTTGCGAGTGGCAG
TCGTTCGTCAACAACCAGTCCAAGCTCGTCTCCGACTTCCAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCGGATGTCATCCCGATCTCG
AAGCCCATCCCCGGCAACCTTCCGTTCTCGTTCTTCCCCCCTGGCAAGAGCATGAAGGATGTTGAGCAGGCT
TGCGCCGAGACCCCCTTCCCCAGCCTCGTCACTCTCCCCGGCCCCGCG
ACCTCTGTCGCTCGCAT
CCCCCCGCCGCCGGGTGCTTAA

Retrieve as FASTA