Entry information : PcLiP07_RF78 (PcLiPG_RF78)
Entry ID 2481
Creation 2009-05-28 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-24 (Christophe Dunand)
Peroxidase information: PcLiP07_RF78 (PcLiPG_RF78)
Name (synonym) PcLiP07_RF78 (PcLiPG_RF78)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP07_RF78
start..stop
S start..stop
PcLiP09_RP78 688 0 1..372 1..372
PcLiP09_ME446 681 0 1..372 1..372
PcLiP02_RP78 671 0 1..372 1..372
PsoLiP07 669 0 1..372 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 448641..448701 61 N° 2 448764..448917 154 N° 3 448968..449024 57 N° 4 449080..449294 215
N° 5 449347..449388 42 N° 6 449440..449518 79 N° 7 449570..449993 424 N° 8 450048..450112 65
N° 9 450171..450192 22  
join(448641..448701,448764..448917,448968..449024,449080..449294,449347..449388, 449440..449518,449570..449993,450048..450112,450171..450192)


exon

Literature and cross-references PcLiP07_RF78 (PcLiPG_RF78)
Literature Stewart,P. and Cullen,D., Organization and differential regulation of a cluster of lignin peroxidase genes of Phanerochaete chrysosporium, J. Bacteriol. 181 (11), 3427-3432 (1999)
Protein ref. UniProtKB:   A7U4T0 [Fragment]
DNA ref. GenBank:   AF140063 JGI genome:   scaffold_19 (448641..450192)
mRNA ref. JGI transcript:   8895
Protein sequence: PcLiP07_RF78 (PcLiPG_RF78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39335.49 (37227.3)  
PI (pH):   %s   4.33 (4.23) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLIAAISVALSLSVAHGAVVKEKRATCSNGATVSDASCCAWFDVLDDIQQNLFQGGQCGAEAHESIRLVFHDSIAISPAMEAQGKFGGGGADGSIIIFDTIETAFHPNIGLDEIVNLQKPFIAKHGVTPGDFIAFAGAVALSNCPGSPQMNFFTGRAATKAAPDGLVPEPFHTVDQLIERVNDAGQFDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQLRGLTFPGSGGNQGEVTSPLPGEIRIQTDHTLARDSRTACEWQSFVANQSKLVSDFQFIFLALTQLGQDPNAMTDCSDVIPISKPIPGNLPFSFFPAGKTMKDVEQCAETPFPSLTTLPGPETSVQRIPPPPGA

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (7 introns). Strain="BKM1767" and "RF78". Adjacent to LipI in the genome. Wrong splicing prediction in the NCBI accession AF140063 (7 introns instead of 8 (Stewart et al.)).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCATCGCAGCGATTTCCGTCGCCCTTTCGCTCTCCGTGGCGCACGGTACGCATTCTTCGGGTCATTCCACCACGAACGATATTGATAATGTGGGCTACGACGTG
CAGGTGCCGTAGTTAAGGAGAAACGTGCCACATGCTCGAACGGTGCCACCGTCAGCGACGCGTCATGCTGCGCCTGGTTCGACGTCCTCGACGACATCCAGCAGAACCTGTTCCAAGGTG
GCCAGTGCGGCGCTGAGGCTCACGAGTCGATCCGCCT
GTAGGTGTCTGAGGTGGTCCTCCTACGTCAATGCACTGAACTGTCTGTAGCGTCTTCCACGACTCGATCGCCATCTCGCCCGC
CATGGAGGCCCAAGGCAAGTTCGG
GTAAGTAGCGGGTACATAGGACAACATCTTGCGGTTACTAAGTGTTCTCGTGCAGCGGTGGAGGTGCTGACGGCTCTATCATCATCTTCGACACGA
TTGAGACTGCGTTCCACCCGAACATTGGCCTCGACGAGATCGTCAACCTGCAGAAGCCGTTCATCGCCAAGCACGGTGTGACCCCCGGAGACTTCATTGCCTTCGCTGGTGCGGTCGCCC
TCAGCAACTGCCCTGGCTCTCCCCAAATGAACTTCTTCACCGGTCGCGCCCCTG
GTATGTTTTATGATCTCTACGCGATTGCTGTAAATACTCATCCGCGCAACAGCTACCAAGGCTGCT
CCCGATGGCCTCGTCCCCGAGCCCTTCC
GTAAGTGGTAATGAAATGAATTGAGCGTCTCATTACTGACTATCCCTTCAGACACTGTCGACCAGCTCATCGAGCGTGTCAACGACGCCGGC
CAGTTCGATGAGCTCGAGCTCGTTTGGATGCTCTCCGC
GTAAGTCACTTACACGCACAACCAGTTGGACTCGACTGACATCTGCTGCAGCCACTCCGTTGCTGCAGTCAACGACGTGGAC
CCGACCGTTCAGGGCCTGCCCTTCGACTCGACCCCCGGAATCTTTGACTCCCAGTTCTTCGTCGAGACTCAGCTCCGTGGCCTCACCTTCCCCGGCTCCGGTGGCAACCAAGGCGAGGTC
ACCTCCCCGCTTCCGGGCGAGATCCGCATCCAGACCGACCACACGCTCGCTCGTGACTCCCGCACGGCGTGCGAGTGGCAGTCGTTCGTCGCGAACCAGTCCAAGCTCGTCTCCGACTTC
CAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCCGACGTCATCCCGATCTCGAAGCCCATCCCCGGCAACCTTCCGTTCTCGTTCTTCCCC
GCCGGCAAGACCATGAAGGATGTCGAGCAGGCC
GTGCGTATTTACCGCTTCGGAAGGCGCCGACGATACTGATAGCTCCTCTTGCAGTGCGCCGAGACGCCCTTCCCGTCGCTCACGACC
CTCCCGGGCCCCGAGACCTCTGTCCAGCGCAT
GTGAGCACCCATTCTGAGTCGATGTTTGGACACCCAATCTAAAGAGTCACCCCAACAGCCCCCCGCCGCCGGGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCATCGCAGCGATTTCCGTCGCCCTTTCGCTCTCCGTGGCGCACGGTGCCGTAGTTAAGGAGAAACGTGCCACATGCTCGAACGGTGCCACCGTCAGCGACGCG
TCATGCTGCGCCTGGTTCGACGTCCTCGACGACATCCAGCAGAACCTGTTCCAAGGTGGCCAGTGCGGCGCTGAGGCTCACGAGTCGATCCGCCT
CGTCTTCCACGACTCGATCGCCATC
TCGCCCGCCATGGAGGCCCAAGGCAAGTTCGG
CGGTGGAGGTGCTGACGGCTCTATCATCATCTTCGACACGATTGAGACTGCGTTCCACCCGAACATTGGCCTCGACGAGATCGTCAAC
CTGCAGAAGCCGTTCATCGCCAAGCACGGTGTGACCCCCGGAGACTTCATTGCCTTCGCTGGTGCGGTCGCCCTCAGCAACTGCCCTGGCTCTCCCCAAATGAACTTCTTCACCGGTCGC
GCCCCTG
CTACCAAGGCTGCTCCCGATGGCCTCGTCCCCGAGCCCTTCCACACTGTCGACCAGCTCATCGAGCGTGTCAACGACGCCGGCCAGTTCGATGAGCTCGAGCTCGTTTGGATG
CTCTCCGC
CCACTCCGTTGCTGCAGTCAACGACGTGGACCCGACCGTTCAGGGCCTGCCCTTCGACTCGACCCCCGGAATCTTTGACTCCCAGTTCTTCGTCGAGACTCAGCTCCGTGGC
CTCACCTTCCCCGGCTCCGGTGGCAACCAAGGCGAGGTCACCTCCCCGCTTCCGGGCGAGATCCGCATCCAGACCGACCACACGCTCGCTCGTGACTCCCGCACGGCGTGCGAGTGGCAG
TCGTTCGTCGCGAACCAGTCCAAGCTCGTCTCCGACTTCCAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCCGACGTCATCCCGATCTCG
AAGCCCATCCCCGGCAACCTTCCGTTCTCGTTCTTCCCCGCCGGCAAGACCATGAAGGATGTCGAGCAGGCC
TGCGCCGAGACGCCCTTCCCGTCGCTCACGACCCTCCCGGGCCCCGAG
ACCTCTGTCCAGCGCAT
CCCCCCGCCGCCGGGTGCTTAA

Retrieve as FASTA