Entry information : PcLiP08_BKMF1767 (LIG3 / GLG3 / PcLiPH_BKMF1767)
Entry ID 2482
Creation 2006-07-05 (Nenad Bakalovic)
Last sequence changes 2011-11-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-24 (Christophe Dunand)
Peroxidase information: PcLiP08_BKMF1767 (LIG3 / GLG3 / PcLiPH_BKMF1767)
Name (synonym) PcLiP08_BKMF1767 (LIG3 / GLG3 / PcLiPH_BKMF1767)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcLiP08_BKMF1767
start..stop
S start..stop
PcLiP01_RP78 745 0 1..372 1..372
PcLiP01_SC26 695 0 28..372 1..345
PcLiP08_RP78 692 0 1..372 1..368
PcLiP07_RF78 673 0 1..372 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140..200 61 N° 2 261..414 154 N° 3 469..525 57 N° 4 579..793 215
N° 5 847..888 42 N° 6 942..1020 79 N° 7 1071..1494 424 N° 8 1549..1613 65
N° 9 1667..1688 22  
join(140..200,261..414,469..525,579..793,847..888,942..1020,1071..1494,1549..161 3,1667..1688)


exon

Literature and cross-references PcLiP08_BKMF1767 (LIG3 / GLG3 / PcLiPH_BKMF1767)
Literature Naidu,P.S. and Reddy,C.A., Nucleotide sequence of a new lignin peroxidase gene GLG3 from the white-rot fungus, Phanerochaete chrysosporium, Nucleic Acids Res. 18 (23), 7173 (1990)
Protein ref. UniProtKB:   P21764
DNA ref. GenBank:   X51590
Protein sequence: PcLiP08_BKMF1767 (LIG3 / GLG3 / PcLiPH_BKMF1767)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39440.34 (37321.2)  
PI (pH):   %s   4.23 (4.19) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLFAAISLALSLSAANAAAVIEKRATCSNGKTVGDASSCAWFDVLDDIQQNLFHGGQCGAEAHESIRLVFHDSIAISPAMEAQGKFGGGGADGSIMIFDDIETAFHPNIGLDEIVKLQKPFVQKHGCTPGDFIAFAGAVALSNCPGAPQMNFFTGRAATQAAPDGLVPEPFHTVDQIINRVNDAGEFDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQLRGTAFPGSGGNQGEVESPLPGEIRIQSDHTIARDSRTACEWQSFVNNQSKLVDDFQFIFLALTQLGQDPNAMTDCSDVIPQSKPIPGNLPFSFFPAGKTIKDVEQCAETPFPTLTTLPGPETSVQRIPPPPGA

Retrieve as FASTA  
Remarks Complete sequence from DNA (8 introns). Strain="BKMF-1767, ATCC 24725"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCTTCGCAGCTATCTCTCTCGCTCTCTCGCTCTCGGCTGCGAACGGTACGCCCATCGCAGTTATCGTTGACCAGTGGACTGCATGCTGAAAGTCGTCTTGTGCA
GCGGCTGCGGTTATCGAGAAGCGCGCCACCTGTTCCAACGGCAAGACCGTCGGCGATGCGTCGTCGTGCGCTTGGTTCGACGTCCTGGATGATATCCAGCAGAACCTGTTCCACGGCGGC
CAGTGCGGCGCTGAGGCGCACGAGTCGATTCGTCT
GTGAGTGATCCCGTCGCGACCTCCTGCTATGCATGTTTGAACGCGCCCGCCCAGCGTCTTCCACGACTCCATCGCAATTTCGCCC
GCCATGGAGGCACAGGGCAAGTTCGG
GTAAGTTGCCACCGCGTTGCGCCACCTAGTCGTTTGCTGATCCCTCCTTGCAGCGGCGGTGGTGCTGACGGCTCCATCATGATCTTCGACGATA
TCGAGACTGCGTTCCACCCTAACATCGGTCTCGACGAGATCGTCAAGCTCCAGAAGCCATTCGTTCAGAAGCACGGTTGCACCCCTGGTGACTTCATCGCCTTCGCTGGTGCTGTCGCGC
TCAGCAACTGCCCTGGTGCCCCGCAGATGAACTTCTTCACTGGTCGCGCGCCTG
GTATGCCTGCAAAACTCGCTTTGCGGATGATACGGACTAATTGTCTGCTTCAGCTACCCAGGCCGC
TCCTGATGGCCTTGTCCCCGAGCCCTTCC
GTAAGTGGTCTTATTCAAGCAGTTAGGTGCGGTCTATACTGACTAGCATGCAGACACTGTCGACCAAATCATCAACCGTGTCAACGACGCA
GGCGAGTTCGATGAGCTCGAGCTTGTCTGGATGCTCTCCGC
GTAAGTCACTCACTGTTGACTTCGACACTCCCTTCCTGAGACCTCGACAGGCACTCCGTCGCAGCGGTGAACGACGTCG
ACCCGACCGTCCAGGGTCTGCCCTTTGACTCGACCCCCGGAATCTTCGACTCCCAGTTCTTCGTCGAGACTCAGCTTCGTGGTACCGCCTTCCCCGGCTCTGGTGGCAACCAAGGCGAGG
TCGAGTCGCCGCTCCCTGGCGAAATTCGCATCCAGTCCGACCACACTATCGCCCGCGACTCACGCACGGCGTGTGAATGGCAGTCCTTCGTCAACAACCAGTCCAAGCTCGTCGATGACT
TCCAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCGGATGTTATCCCGCAGTCCAAGCCCATCCCTGGCAACCTCCCATTCTCGTTCTTCC
CCGCTGGCAAGACCATCAAAGACGTTGAGCAGGCG
GTGCGTATTTCACCCCACCATGCAGTAGAGTGGCTGCTGAACATCGCATGACAGTGTGCGGAGACCCCCTTCCCGACTCTCACCA
CTCTCCCGGGCCCCGAGACGTCCGTCCAGCGCAT
GTGAGTACAATCCATGAGATCTTTCAATCTGTGCTGACATGCTCCTTCTCCAGCCCTCCGCCTCCGGGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCTTCGCAGCTATCTCTCTCGCTCTCTCGCTCTCGGCTGCGAACGCGGCTGCGGTTATCGAGAAGCGCGCCACCTGTTCCAACGGCAAGACCGTCGGCGATGCG
TCGTCGTGCGCTTGGTTCGACGTCCTGGATGATATCCAGCAGAACCTGTTCCACGGCGGCCAGTGCGGCGCTGAGGCGCACGAGTCGATTCGTCT
CGTCTTCCACGACTCCATCGCAATT
TCGCCCGCCATGGAGGCACAGGGCAAGTTCGG
CGGCGGTGGTGCTGACGGCTCCATCATGATCTTCGACGATATCGAGACTGCGTTCCACCCTAACATCGGTCTCGACGAGATCGTCAAG
CTCCAGAAGCCATTCGTTCAGAAGCACGGTTGCACCCCTGGTGACTTCATCGCCTTCGCTGGTGCTGTCGCGCTCAGCAACTGCCCTGGTGCCCCGCAGATGAACTTCTTCACTGGTCGC
GCGCCTG
CTACCCAGGCCGCTCCTGATGGCCTTGTCCCCGAGCCCTTCCACACTGTCGACCAAATCATCAACCGTGTCAACGACGCAGGCGAGTTCGATGAGCTCGAGCTTGTCTGGATG
CTCTCCGC
GCACTCCGTCGCAGCGGTGAACGACGTCGACCCGACCGTCCAGGGTCTGCCCTTTGACTCGACCCCCGGAATCTTCGACTCCCAGTTCTTCGTCGAGACTCAGCTTCGTGGT
ACCGCCTTCCCCGGCTCTGGTGGCAACCAAGGCGAGGTCGAGTCGCCGCTCCCTGGCGAAATTCGCATCCAGTCCGACCACACTATCGCCCGCGACTCACGCACGGCGTGTGAATGGCAG
TCCTTCGTCAACAACCAGTCCAAGCTCGTCGATGACTTCCAGTTCATCTTCCTCGCCCTCACCCAGCTCGGCCAGGACCCGAACGCGATGACCGACTGCTCGGATGTTATCCCGCAGTCC
AAGCCCATCCCTGGCAACCTCCCATTCTCGTTCTTCCCCGCTGGCAAGACCATCAAAGACGTTGAGCAGGCG
TGTGCGGAGACCCCCTTCCCGACTCTCACCACTCTCCCGGGCCCCGAG
ACGTCCGTCCAGCGCAT
CCCTCCGCCTCCGGGTGCTTAA

Retrieve as FASTA