Entry information : PpaPrx11
Entry ID 251
Creation 2008-08-05 (Christophe Dunand)
Last sequence changes 2008-08-05 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx11
Name PpaPrx11
Class Class III peroxidase    [Orthogroup: Prx072]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx11
start..stop
S start..stop
PpaPrx17 511 0 1..341 1..340
PpaPrx24 346 4.87e-119 38..341 28..330
PpaPrx25 335 1.29e-114 13..341 2..333
SmPrx35-1_84 319 1.14e-108 20..341 12..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '251' 'join(895076..895318,895506..895697,895817..895994,896124..896536)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 895076..895318 241 N° 2 895506..895697 190 N° 3 895817..895994 176 N° 4 896124..896536 411
join(895076..895318,895506..895697,895817..895994,896124..896536)


exon

Literature and cross-references PpaPrx11
Literature Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants.
DNA ref. Phytozome 12:   scaffold_89 (895076..896536)
Cluster/Prediction ref. UniGene:   Ppa.10516 [5' end]
Protein sequence: PpaPrx11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (308)
PWM (Da):   %s   36652.98 (33176.1)  
PI (pH):   %s   4.36 (4.28) Peptide Signal:   %s   cut: 34 range:34-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGLDFSRRSSAAESCFVVVIALSLLLVTQVRAQNIGVGFYDQSC
PRAESIVTETVREFNSRDATVPAALLRLLFHDCFVE
GCDGSLLLDPSPENPDVEKAASPNLTVRGYDVIDAAKARLEVECPQTVSCADIVALAARDSAVLAGLNFQGLPLTMATGRWDGRVSSRNAAEAALPSSKSNVQQLTAQFSNKGLSQDEMV
TLS
GAHSIGVAHCSNFMDRLYDFPGSPNGVDPTLDPDYAAELQAKCPRGNPNPNTVVNMDPQTPFVIDNNFYSNGFAGKVLFSSDMALFNDFETQFTSDLNVVNGITWNQKFGNALAQMA
AIDIKDDFDGEVRLNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGGGCTGGACTTCAGCAGGCGAAGCTCGGCGGCGGAGTCTTGCTTCGTGGTGGTCATTGCATTGAGCTTGTTGCTTGTAACTCAGGTGCGAGCTCAAAATATAGGCGTGGGATTC
TACGACCAAAGCTGTCCGCGGGCAGAGAGCATTGTCACCGAGACAGTGAGAGAGTTCAACTCGAGGGATGCCACCGTTCCTGCTGCATTGCTCCGTCTCCTGTTCCACGATTGCTTCGTT
GAG
AGGTACAGTGCAATGCCTTCCTACAATTCATGCTATTGATGTCCCAATGCTTTGAGACATAGTTTTAGCGCGGACTGTTAACATCTTCCAGTTCAAGTTTATATGGAGTCTTGTCTC
AGGCTTTGTTCGGGGTCATTGAAAAGGCATAGTTGGGTTTGTGACCATAGTCTGATGTAACTTTCAATGCAGGGTTGTGATGGGTCATTGCTCTTGGACCCAAGTCCCGAAAATCCCGAC
GTCGAGAAAGCGGCGTCCCCCAACCTAACAGTGCGGGGCTACGACGTCATCGACGCTGCAAAGGCACGCCTCGAAGTTGAGTGTCCACAGACTGTCTCCTGCGCCGACATTGTCGCTCTT
GCTGCGAGGGATTCCGCCGTACTT
TTGTATGCAACCTCCCCCTAATGCCCCATTGTGTCTGCTTCGTCGCTCCCCCTTTCAGATTACTAACGTAAACCCTTGTCGGAATCCAACTAAAGT
GGAGAGTGCTTTCTGATGCGATCAGGCTGGGTTGAATTTTCAAGGCCTCCCCTTAACTATGGCGACTGGACGATGGGATGGGCGCGTTTCCAGCAGAAATGCCGCGGAGGCTGCACTTCC
TTCTTCGAAATCTAATGTGCAGCAGCTGACAGCGCAGTTTAGTAACAAGGGTCTTTCTCAAGACGAAATGGTGACTCTCTCAG
AGGTACGTAATCAGCAACCCCATTATTTGTTCTCAGT
TCATTAAACTTCATCAACACCACGTCCATGATATCTGAAAACAGTTGCAAGTGGAGAATATCGAGCTCACAGTGAAACTGGGAATCGATGGCAGGTGCTCACTCAATCGGCGTAGCCCAC
TGCTCGAACTTCATGGACCGGCTCTACGACTTCCCAGGGTCGCCGAATGGAGTGGATCCCACGCTGGACCCTGACTACGCCGCTGAATTGCAGGCAAAGTGTCCTCGAGGTAACCCCAAC
CCAAACACGGTAGTAAACATGGACCCCCAAACGCCCTTCGTCATCGACAACAACTTCTACAGCAATGGATTCGCCGGCAAAGTGCTGTTCAGCTCCGACATGGCACTCTTCAACGACTTC
GAAACCCAGTTCACGTCCGACCTGAACGTCGTGAACGGGATCACTTGGAACCAGAAGTTCGGCAACGCTTTGGCTCAGATGGCCGCCATAGATATCAAGGACGACTTCGACGGCGAGGTT
CGTCTCAACTGCCGCAGGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGGGCTGGACTTCAGCAGGCGAAGCTCGGCGGCGGAGTCTTGCTTCGTGGTGGTCATTGCATTGAGCTTGTTGCTTGTAACTCAGGTGCGAGCTCAAAATATAGGCGTGGGATTC
TACGACCAAAGCTGTCCGCGGGCAGAGAGCATTGTCACCGAGACAGTGAGAGAGTTCAACTCGAGGGATGCCACCGTTCCTGCTGCATTGCTCCGTCTCCTGTTCCACGATTGCTTCGTT
GAG
GGTTGTGATGGGTCATTGCTCTTGGACCCAAGTCCCGAAAATCCCGACGTCGAGAAAGCGGCGTCCCCCAACCTAACAGTGCGGGGCTACGACGTCATCGACGCTGCAAAGGCACGC
CTCGAAGTTGAGTGTCCACAGACTGTCTCCTGCGCCGACATTGTCGCTCTTGCTGCGAGGGATTCCGCCGTACTT
GCTGGGTTGAATTTTCAAGGCCTCCCCTTAACTATGGCGACTGGA
CGATGGGATGGGCGCGTTTCCAGCAGAAATGCCGCGGAGGCTGCACTTCCTTCTTCGAAATCTAATGTGCAGCAGCTGACAGCGCAGTTTAGTAACAAGGGTCTTTCTCAAGACGAAATG
GTGACTCTCTCAG
GTGCTCACTCAATCGGCGTAGCCCACTGCTCGAACTTCATGGACCGGCTCTACGACTTCCCAGGGTCGCCGAATGGAGTGGATCCCACGCTGGACCCTGACTACGCC
GCTGAATTGCAGGCAAAGTGTCCTCGAGGTAACCCCAACCCAAACACGGTAGTAAACATGGACCCCCAAACGCCCTTCGTCATCGACAACAACTTCTACAGCAATGGATTCGCCGGCAAA
GTGCTGTTCAGCTCCGACATGGCACTCTTCAACGACTTCGAAACCCAGTTCACGTCCGACCTGAACGTCGTGAACGGGATCACTTGGAACCAGAAGTTCGGCAACGCTTTGGCTCAGATG
GCCGCCATAGATATCAAGGACGACTTCGACGGCGAGGTTCGTCTCAACTGCCGCAGGATCAACTGA

Retrieve as FASTA