Entry information : BnaAPx01
Entry ID 2512
Creation 2006-07-05 (Nenad Bakalovic)
Last sequence changes 2012-01-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaAPx01
Name BnaAPx01
Class Ascorbate peroxidase    [Orthogroup: APx2002]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation Chloroplastic
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaAPx01
start..stop
S start..stop
KmAPx01 291 3.92e-99 2..234 91..336
MpuAPx01 284 2.2e-96 2..235 90..338
OtAPx01 290 1.23e-93 2..226 87..312
OmarAPx01 275 3.38e-93 2..226 70..305
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2512' 'complement(join(200014..200058,200169..200246,200365..200418,200507..200577,200719..200756,200862..200932,201010..201058,201170..201313,201369..201421,201503..201547,201639..201698)) ' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 201639..201698 58 N° 2 201503..201547 43 N° 3 201369..201421 51 N° 4 201170..201313 142
N° 5 201010..201058 47 N° 6 200862..200932 69 N° 7 200719..200756 36 N° 8 200507..200577 69
N° 9 200365..200418 52 N° 10 200169..200246 76 N° 11 200014..200058 43  
complement(join(200014..200058,200169..200246,200365..200418,200507..200577,2007 19..200756,200862..200932,201010..201058,201170..201313,201369..201421,201503..2 01547,201639..201698))


exon

Literature and cross-references BnaAPx01
Literature Archibald,J.M. et al., Lateral gene transfer and the evolution of plastid-targeted proteins in the secondary plastid-containing alga Bigelowiella natans, Proc. Natl. Acad. Sci. U.S.A. 100 (13), 7678-7683 (2003)
Protein ref. UniProtKB:   Q7XYM2
DNA ref. JGI genome:   scaffold_1 (201698..200014)
EST ref. GenBank:   32307533
Cluster/Prediction ref. JGI gene:   51415
Protein sequence: BnaAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235 (298)
PWM (Da):   %s   26081.12 (32853.9)  
PI (pH):   %s   9.61 (8.73) Peptide Signal:   %s   cut: 32 range:32-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MELGHGANAGLIKAVNYLKKIKEAHPIISWADLIQLGSATAIEHAGGPKIPMRYGRVDTVTKEECPKEGNLPDAYPPFGDGAPSAGRHLRNVFYRMGFNDREIVALSGAHTIGRAFKERS
GVVPNGYGEDTATKFTCPMHRARADKSTGVGMPGGKSWTANWLTFDNSYFHRQNDTKDLLWMPTDQVLHKDESFKVFFAMYAKDKNLFFSDYAKVHKKLSELGSKFSPKEGITLD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAACTTGGACACGGTGCGAACGCTGGCTTGATCAAGGCGGTAAATTATCTGAAAAAGGTGGTAACTTGTTCCGATAAATACAAATTATTCTTTCGATACAATTTCATCGACAAAGAT
TGATTCACTGACGCCTTGCAACACACTATAGATATCAAGGAGGCGCACCCCATCATATCCTGGGCTGACTTGATTCAGGTTTGTTGTCCTAATAACATCATTCCGATGATAAAATTTTCC
TTGAAGCAAGGACTCTTGAAATATCCCCCTACTTTATAGTTTTGGGAAGTGCCACAGCTATCGAGCACGCAGGAGGTCCCAAAATCCCGATGAGGTAGTAAGCAAGTAGCGTACGTGGAT
GAATCGTTCATGAAATGGTGCTGCAATAGATATATGGAAGAGTCGACACTGTGACCAAGGAGGAGTGCCCGAAAGAGGGAAATCTTCCCGACGCCTACCCCCCGTTTGGAGATGGAGCTC
CATCCGCTGGCCGCCACTTAAGAAACGTGTTCTACCGTATGGGCTTTAATGACAG
GTGGGAGAGGATTGCATGTTGATTACTTGCATGATTACTACACTACGTAATGGCACGAATGATGT
TACGCCGTCGCCTCATCCGGATCCAAAGCTCTCTTCTCTTCTATAGGGGGAGATCGTGGCCCTTTCTGGGGCGCATACTATTGGCCGTGCTTTTAAGGTTTCGATACTGCTTTTTCACCA
TTCCGCACGTATATCCCGAGTGACTCATCCGCCTAAACATGTTTTGGTTTGAAGGAGAACGCAGTGGAGTTGTGCCAAATGGCTACGGTGAAGATACAGCAACCAAATTTACTTGCCCGA
TGCACCG
GTATTGTAGTAATTTAACCACACTGCTGCTTCTCGTTTCCAGTGTTAAAGGAGTCTTACTGCTGCGTTTACCCCCCCCTCCCATTCCACTTTTTACTTGATTTAGCGCGCTAG
GGCTGATAAGTCGACAGGCGTTGGGATGCCGG
GTAATTTTATGGTGATCACGACTCAAGATATTTTTTCTCTTACTCCTCTCTCTCTATCTCTCTCTTTTGGTGTGTGTGCGTGTGTGTG
TGTGTGCCCACAAATTCTCCATAATTAACCGACCATACCCTCTAAATTAAAAGGAGAGGAAAGTCTTGGACTGCAAACTGGTTGACGTTTGATAACTCATATTTCCATCGCCAAAACGAC
ACGAAG
GTAGCTGCTCAAATAGACACCGAGAATCTTCTTACGTACTTGATGTCCTTATGTTCTAAGATAAATGCTATTTCTCATATGCGGATAGGAGACTTGCTCTGGATGCCAACAGAC
CAGGTTCTCCACAAGGATGAGAGCTTTAAG
GTCATCTGCATTTATTTCCCTCCCTCCCCCCAAATGATGTAGAGGAGCTCAAATTTGGGAGCAACTTCTGATGATACGTTGTCTGAACAT
TGTGAAAAACAAACGTTAAATCGGGCAGGTGTTTTTTTTGCAATGTACGCGAAAGATAAGAATCTCTTCTTCAGCGACTATGCCAAAGTGCACAAGAAGCTCTCTGAGGTTTACAGATGT
CACTTCTATGTTCTGCATGATGAGAACCGTAGCCTCCTCCGACTTTGGATCTCTCTTCAATTAATTTTCTTTCCTTACTTTCTTTCATACTCCATCAGCTCTGGGCTCCAAGTTCAGTCC
TAAGGAAGGAATCACTCTAGATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAACTTGGACACGGTGCGAACGCTGGCTTGATCAAGGCGGTAAATTATCTGAAAAAGATCAAGGAGGCGCACCCCATCATATCCTGGGCTGACTTGATTCAGTTGGGAAGTGCCACA
GCTATCGAGCACGCAGGAGGTCCCAAAATCCCGATGAG
ATATGGAAGAGTCGACACTGTGACCAAGGAGGAGTGCCCGAAAGAGGGAAATCTTCCCGACGCCTACCCCCCGTTTGGAGAT
GGAGCTCCATCCGCTGGCCGCCACTTAAGAAACGTGTTCTACCGTATGGGCTTTAATGACAG
GGAGATCGTGGCCCTTTCTGGGGCGCATACTATTGGCCGTGCTTTTAAGGAACGCAGT
GGAGTTGTGCCAAATGGCTACGGTGAAGATACAGCAACCAAATTTACTTGCCCGATGCACCG
CGCTAGGGCTGATAAGTCGACAGGCGTTGGGATGCCGGGAGGAAAGTCTTGGACTGCA
AACTGGTTGACGTTTGATAACTCATATTTCCATCGCCAAAACGACACGAAG
GACTTGCTCTGGATGCCAACAGACCAGGTTCTCCACAAGGATGAGAGCTTTAAGGTTTTTTTTGCAATG
TACGCGAAAGATAAGAATCTCTTCTTCAGCGACTATGCCAAAGTGCACAAGAAGCTCTCTGAG
CTGGGCTCCAAGTTCAGTCCTAAGGAAGGAATCACTCTAGATTAA

Retrieve as FASTA