Entry information : SpuCcP01 (SPPG_06463.3)
Entry ID 2564
Creation 2005-11-23 (Christophe Dunand)
Last sequence changes 2013-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-07 (Christophe Dunand)
Peroxidase information: SpuCcP01 (SPPG_06463.3)
Name (synonym) SpuCcP01 (SPPG_06463.3)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Spizellomycetaceae Spizellomyces
Organism Spizellomyces punctatus    [TaxId: 109760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpuCcP01
start..stop
S start..stop
MrubCcP01 392 2e-136 13..360 21..352
KpfeCcP01 390 4e-135 2..362 4..384
MimpCcP01 385 1e-133 3..362 5..369
MconCcP01 385 1e-133 3..362 5..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 189197..189446 250 N° 2 189543..189654 112 N° 3 189726..189963 238 N° 4 190020..190147 128
N° 5 190205..190595 391  
join(189197..189446,189543..189654,189726..189963,190020..190147,190205..190595)


exon

Literature and cross-references SpuCcP01 (SPPG_06463.3)
Literature Liu,Y. and Lang,B.F. Phylogenomic analysis of chytrid fungi Unpublished (2006)
EST ref. GenBank:   EB746409.1 [5' end]   EB745262.1 [Fragment]
Cluster/Prediction ref. Broad:   S7000007187936880
Protein sequence: SpuCcP01 (SPPG_06463.3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372
PWM (Da):   %s   41438.9  
PI (pH):   %s   9.17
Sequence 413
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNARTVASLTLRSVRSSVLRPRVTVLSTTTAFRRGYATGEQQPSGQQHAGPKGKGSNNLLWAAVAGAAGIGGYYYYRFTQGDLTEAIPHSPTKSKLTPAQFQEVYNDIAKLLDSNPDYDDGSYAPVLVRLAWHASGTYSKHDNTGGSYGATMRFPIEAEWSANAGLKVARDLLEPIKKKYGDALSYSDLWSVGGVAAIQEMGGPTIKWRPGRVDQTADKTTPDGRLPDANAEHPNHHREIFYRMGFNDQEIVALLGAHAIGRCHTSRSGFDGPWTFSPTTFSNDFYKRLLEEKWVVKKWKGPKQYVDKNTGSIMMLPTDMSLTKDKEFKKWVEIYAKDEERFFEDFAKAYQKLLELGVPFEEGTPVIEFKRL

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACGCACGCACTGTAGCTTCTCTTACCCTCAGATCAGTACGGTCATCGGTGCTTCGCCCACGCGTCACCGTATTGTCAACGACCACTGCTTTCCGACGTGGGTATGCCACGGGCGAGC
AGCAGCCATCAGGACAACAACATGCTGGGCCAAAGGGGAAAGGAAGCAACAACTTGCTTTGGGCTGCTGTAGCTGGCGCAGCGGGTATCGGTGGCTACTATTATTATCGGTTTACTCAGG
GCGATCTCA
GTAAGTACATTGACCTAAACTTCCTCCCCATAAAAGTTGAAAATTTTGTATTTCATCGGGATATGTGACTTACGGTATTACTTTTCACCCCCACAGCCGAAGCGATTCCTC
ACAGCCCTACAAAATCCAAACTTACCCCCGCACAATTCCAAGAAGTGTACAACGACATTGCCAAGCTCCTCGACTCTAACCCAGATTATGATGATGG
GTTAGTGTTGTCGTATATATCAA
GTGCACAGGGAGATGTCAGAGGTTTTAACCAAGGTCCATTGCATCTAGCTCGTACGCGCCCGTTCTCGTACGTCTAGCCTGGCATGCCAGTGGCACATATAGCAAGCACGACAACACGGG
TGGATCGTATGGCGCCACGATGCGATTCCCCATCGAAGCCGAATGGTCGGCGAATGCTGGCTTGAAAGTTGCTCGGGATCTTCTTGAACCCATCAAGAAAAAGTATGGTGATGCTCTGAG
CTATTCGGACTTGTGGAGTGTGGGTGGTGTTGCTGCGATCCAAGAG
GTATATCGCTTTCCTTCTGATTTTTGTTTTGCATAAGCTGATCAACCTGTTGGCAGATGGGTGGGCCTACCATT
AAATGGCGTCCAGGTCGTGTCGATCAAACTGCTGACAAGACGACGCCGGATGGTCGACTACCTGATGCCAACGCCGAACACCCGAACCATCACCGTGAGATTTTCTACAG
GTAAATTGTA
GTGTAATTAGCAAAAAAATGGGCGGGTAACTAATCTACTCCTGTCAGGATGGGCTTCAATGATCAAGAAATTGTCGCCCTGCTGGGTGCCCACGCCATAGGTCGATGCCACACCTCTCGC
TCGGGTTTCGATGGCCCGTGGACTTTCTCCCCTACCACTTTCTCCAATGACTTTTACAAACGCCTCTTGGAAGAGAAATGGGTCGTGAAAAAGTGGAAGGGACCGAAGCAATACGTTGAC
AAGAACACGGGATCGATCATGATGTTGCCTACGGACATGTCCCTCACCAAGGATAAGGAGTTTAAGAAATGGGTGGAGATTTATGCGAAGGATGAGGAGCGGTTCTTTGAAGACTTTGCA
AAGGCGTACCAGAAGTTGTTGGAACTCGGTGTTCCATTTGAGGAGGGTACACCTGTGATTGAGTTTAAGCGGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACGCACGCACTGTAGCTTCTCTTACCCTCAGATCAGTACGGTCATCGGTGCTTCGCCCACGCGTCACCGTATTGTCAACGACCACTGCTTTCCGACGTGGGTATGCCACGGGCGAGC
AGCAGCCATCAGGACAACAACATGCTGGGCCAAAGGGGAAAGGAAGCAACAACTTGCTTTGGGCTGCTGTAGCTGGCGCAGCGGGTATCGGTGGCTACTATTATTATCGGTTTACTCAGG
GCGATCTCA
CCGAAGCGATTCCTCACAGCCCTACAAAATCCAAACTTACCCCCGCACAATTCCAAGAAGTGTACAACGACATTGCCAAGCTCCTCGACTCTAACCCAGATTATGATGATG
G
CTCGTACGCGCCCGTTCTCGTACGTCTAGCCTGGCATGCCAGTGGCACATATAGCAAGCACGACAACACGGGTGGATCGTATGGCGCCACGATGCGATTCCCCATCGAAGCCGAATGGT
CGGCGAATGCTGGCTTGAAAGTTGCTCGGGATCTTCTTGAACCCATCAAGAAAAAGTATGGTGATGCTCTGAGCTATTCGGACTTGTGGAGTGTGGGTGGTGTTGCTGCGATCCAAGAG
A
TGGGTGGGCCTACCATTAAATGGCGTCCAGGTCGTGTCGATCAAACTGCTGACAAGACGACGCCGGATGGTCGACTACCTGATGCCAACGCCGAACACCCGAACCATCACCGTGAGATTT
TCTACAG
GATGGGCTTCAATGATCAAGAAATTGTCGCCCTGCTGGGTGCCCACGCCATAGGTCGATGCCACACCTCTCGCTCGGGTTTCGATGGCCCGTGGACTTTCTCCCCTACCACTT
TCTCCAATGACTTTTACAAACGCCTCTTGGAAGAGAAATGGGTCGTGAAAAAGTGGAAGGGACCGAAGCAATACGTTGACAAGAACACGGGATCGATCATGATGTTGCCTACGGACATGT
CCCTCACCAAGGATAAGGAGTTTAAGAAATGGGTGGAGATTTATGCGAAGGATGAGGAGCGGTTCTTTGAAGACTTTGCAAAGGCGTACCAGAAGTTGTTGGAACTCGGTGTTCCATTTG
AGGAGGGTACACCTGTGATTGAGTTTAAGCGGCTGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGACTTGTAG CTAGAACGGA GGTACCTCCG GTGCGGCTGG ATGTGTCACC GAGCTTCGAA TTACAAACCA GCCACAGCAT AAAAGGGGCC CGAGTGCTTC GCGCCTATCT CGCCTTACCC  TTCCTTCCTG TCAATATCTC ACTCATTTAG CGATGAACGC ACGCACTGTA GCTTCTCTTA CCCTCAGATC AGTACGGTCA TCGGTGCTTC GCCCACGCGT CACCGTATTG TCAACGACCA  CTGCTTTCCG ACGTGGGTAT GCCACGGGCG AGCAGCAGCC ATCAGGACAA CAACATGCTG GGCCAAAGGG GAAAGGAAGC AACAACTTGC TTTGGGCTGC TGTAGCTGGC GCAGCGGGTA  TCGGTGGCTA CTATTATTAT CGGTTTACTC AGGGCGATCT CACCGAAGCG ATTCCTCACA GCCCTACAAA ATCCAAACTT ACCCCCGCAC AATTCCAAGA AGTGTACAAC GACATTGCCA  AGCTCCTCGA CTCTAACCCA GATTATGATG ATGGCTCGTA CGCGCCCGTT CTCGTACGTC TAGCCTGGCA TGCCAGTGGC ACATATAGCA AGCACGACAA CACGGGTGGA TCGTATGGCG  CCACGATGCG ATTCCCCATC GAAGCCGAAT GGTCGGCGAA TGCTGGCTTG AAAGTTGCTC GGGATCTTCT TGAACCCATC AAGAAAAAGT ATGGTGATGC TCTGAGCTAT TCGGACTTGT  GGAGTGTGGG TGGTGTTGCT GCGATCCAAG AGATGGGTGG GCCTACCATT AAATGGCGTC CAGGTCGTGT CGATCAAACT GCTGACAAGA CGACGCCGGA TGGTCGACTA CCTGATGCCA  ACGCCGAACA CCCGAACCAT CACCGTGAGA TTTTCTACAG GATGGGCTTC AATGATCAAG AAATTGTCGC CCTGCTGGGT GCCCACGCCA TAGGTCGATG CCACACCTCT CGCTCGGGTT  TCGATGGCCC GTGGACTTTC TCCCCTACCA CTTTCTCCAA TGACTTTTAC AAACGCCTCT TGGAAGAGAA ATGGGTCGTG AAAAAGTGGA AGGGACCGAA GCAATACGTT GACAAGAACA  CGGGATCGAT CATGATGTTG CCTACGGACA TGTCCCTCAC CAAGGATAAG GAGTTTAAGA AATGGGTGGA GATTTATGCG AAGGATGAGG AGCGGTTCTT TGAAGACTTT GCAAAGGCGT  ACCAGAAGTT GTTGGAACTC GGTGTTCCAT TTGAGGAGGG TACACCTGTG ATTGAGTTTA AGCGGCTGTA GACCGCTAAA ATGGGAATTG TACTGGAAGG GCAAATGAGC TTGGATACGT 
CATAGCAACA CTAAAGGACG TCATATTATG AAAATTGTAA CTAGGATCTG AAATAGGGAA ATAAAGCACG ATACGATCAA ATCA 

Retrieve as FASTA