Entry information : MtPrx[P]06 (Medtr2g008730.1[4.0] / Medtr2g008730.1[3.5] / Medtr2g008780.1[3.0])
Entry ID 2585
Creation 2009-01-05 (Christophe Dunand)
Last sequence changes 2014-01-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Harold Duruflé
Last annotation changes 2016-06-17 (Harold Duruflé)
Peroxidase information: MtPrx[P]06 (Medtr2g008730.1[4.0] / Medtr2g008730.1[3.5] / Medtr2g008780.1[3.0])
Name (synonym) MtPrx[P]06 (Medtr2g008730.1[4.0] / Medtr2g008730.1[3.5] / Medtr2g008780.1[3.0])
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation Cytosolic
Tissue type Sprouting eyes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx[P]06
start..stop
S start..stop
MtPrx06 577 0 1..315 1..325
AhPrx05 505 0 5..315 11..330
LjPrx07 494 2e-178 1..315 1..326
GmPrx05 490 1e-176 2..315 3..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1591372..1591738 367 N° 2 1592244..1592406 163 N° 3 1593314..1593732 419  
join(1591372..1591738,1592244..1592406,1593314..1593732)


exon

Literature and cross-references MtPrx[P]06 (Medtr2g008730.1[4.0] / Medtr2g008730.1[3.5] / Medtr2g008780.1[3.0])
DNA ref. Phytozome 12:   chr2 (1591372..1593732)
Cluster/Prediction ref. Phytozome Gene 12:   31064530
Protein sequence: MtPrx[P]06 (Medtr2g008730.1[4.0] / Medtr2g008730.1[3.5] / Medtr2g008780.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (291)
PWM (Da):   %s   32991.76 (30372.2) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.98 (8.04) Peptide Signal:   %s   cut: 25 range:25-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MECTLLKVVFILLVLGILNTLVHGQGTRVGFYSSTCSQAESIVKSTVTSHVNSDSSLAPGxxGCDASVLVAGSGTEKTAFPNLGLRGFEVIEDAKTKLEAACPGVVSCADILSLAARDSVVLSGGLSWQVLTGRRDGRVSQASDVNNLPAPSDSVDVQKQKFAAKGLNTQDLVTLVGGHTIGTTACQFFSNRLRNFTTNGAADPSIDPSFLSQLQTLCPQNSGATNRIALDTGSQNKFDNSYYANLRNGRGILQSDQALWNDASTKTFVQRYLGLRGLLGLTFNVEFGNSMVKMSNIGVKTGVDGEIRKICSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome ('FHDC' is missing): error of assembly or pseudogene.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCAGATCT TGACAAAAAA TGTATAATCC ATTTTTTAAA TTTAGAATTG ATATATATTC TAAAAAAATA TAGCATTTTT TTAATTATTA TAGAAAACTG TTTATTTACT AAAACAGTTT  ATATAAAACG TTTTTTTTTT TTTTTTATTA TTTTGGGTTT TTTTTTTAAT TTATGTAGTA ATGAGTCTGA TTTTTTTACT AGTAAAACTG TTTGTTAAAT AAAAATACTT GATAAAAAAA  TAATATACTA AAAAGGTTTA TTGTTGGAAA ACAGTTTTTA AAAATAGTGT ATTAAAAATA AGTTTTTATT TTAAATTAAA ACTATGTTAA AATAATTTTT ATAAAAAAAA AAATAAAGCT  GTTTTTATAA TAAATTAAAA AATGTGTTTA AACTAAAACA ATTTATAAAT AAAAAAAATA CACTAATAAG GCCTTTTATT CAAAATAATA ATTATATATT TGCGCATAAA ATTGTTATTT  GCGAATAAAA TTGTTATTTG TTCTTTGCGC GTAAAATTAT ATGTGTCCAT GTAAAATTTT TATTTGTTGT TTGCGTGTAA AATTATATGT TGGCGTGTAA ATTAAATTTT AAGAGAATTA  ATTATATTTT AAAAAACAAT TTTGAAAAAA GTACGAGTTT TATTTATTAA TTAAAATTAT TTTAAAAACA TTTTATTAAT TATTAAAAAA TTGGTTTATA AAATAAAATT TAAAAAAAAA  TATATATATA TATATATATA TAATTTCCTA GGGGTTAAAT CCCTCGCAAA GGCCTTGGTT TATAAAGATA ATCTGTTGAT TTGACATTTC GTCAGTCAGC AGTCAAGTTA GAGCAGACTG  CATAGTTCAG AGCAGACTGC AAAGTTGCAG AAGAAAGTGA GGGAATATGC TAGGGGTTAT ATCAGGGAAA ATGCCAGGCG ATATACCAAG GGTTTAGCCC CTCATTTTTT TTTTCAGGGG  TGTAACCCCT GACAAAATGT TAGCGACGAG CGCTTTTGCG AGTGCTTCCG CCCCTGGGAA ATTCCCTCAC AAACGTCCCG TTTGTCAGGG ATTCTGTCCT TTTCTCAGGA ATTTTGCCCC  TAGCAAAAGG TAATGTTTCT TGTAGTTAAA TAACCTTAAA GGTTGAGACT TTTTATTTAA CGTGAAGATG TTATAAAGCA AGGCAGCGCT GGTGAAAAGA TTCCATCGTC ATATAATAAG  TATACTTGCT AAAATATGCA TAGAATTTCA TCATCAAAGG GTGGAAGTTT AGGATGCTTG TTCTCTCATG AACAAACATG TTGCTAAAGA AGACATGATT AATTGATTTC ACATAGTTTT  TTTATTTCAA AAATAAGTTT TCTGATTTAT TAAAATTATT TTTTAAATAG TAAATAATTA AAATTGCCAT CTAGATACCA TGTATACAAA TTTGTATAGT CAGCACTTGC CACATAAACA  AAAATGAGCC AAATCAACAA GAAAGTGGAT TCAGGGACTT TTTTAAAAAA CAAAAAATTT TGCAGGGATG AAATTAAAAA AAAAAAATTA TCAGAGACCA AAATCTAAAC TCGTTATATT  TTCAAGGACC AAAAACATAT TTTAGCCTTA TTTTTATATT AAACACATTC AAAACAAATA AGATAAAGTA ATACACTTTT GATAAAAATA TATATACACA TATATTTACT CATTCATATA  TTGTATAGCA TAGCATCCAC CTATTACTCA GTCTCATTCC CACACCCACC CACCATATAC GTACATATAT TATATCCAAT TATCGATATA TAGATCATTT CAATTATTTT TAGCTGCCTC  AATTATTATT CCTTTGCTTA CTCATTCTCT TCATTTCGAT CGACCCCAAA AATCCAAGCC TATTTTCCAT ATAAATACTT ACACCCCATG CATCTCATTT GCATTGCATT TCAAACTTCT 
AAACAATTAT ACATTTCCTT TCATACATAA ATTTTAGTTC ACTTCATTAT AACTTCTTCT TGAATTTCTT ACAAAAATAT 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATATGT GGTTTTATTG ATTTGTTTGT ACTTTGTATT GTTGGAATGT TTGCCATTGA TTGAAGTGTA TAATATTTAC TTGTAGTTTG TTTTTTTTTT CTCTTTTTTT TTGTTGACCA  AACTAAAAAT GTTGAAAGTG TAAAATTATT AAAAGAAAAT TGTGATATGT ATTATATACT AATAATACAA ACAATTTTTT CACTGATGTC ACAAAAAAAA ACATGGGACT TAACTCTAGA  GGCTTATGTC ACTATGACTG ATTGCACACT AAGACAATAT TGGCCGTCCT GACTGAAAAA CATAGCAAGA AGAATCCAAC CTTTTTCAAG TTCATATACA GCTTTACACG ACATGTCCAA  GGTTGTTTTT GTATCAAACT ATGTAGAAAA TCACATCATG TCATATATCT TATTATTCTC AAAAGAATAT CAATAGGTAG ATGCCCTTGT TATTGTCTTC AACTAGCAAT GACTAATTAG  GTATATTGAA GATAGAAATG AGTCTCATGA TTCATTTCCA CTCCTAAATT TTCCATGCCA TAGCTACAAT ACTTCTTTCA ATCTCAACTT CATGATGAGG TTTCCCCTTT TTGTTCCTCA  ACTTATTACT TTTTCAGTTC TTGCAATGGC TCAAGAAGGA CCTAAAGGGG ATAATGAAGT CCAAAATAAA TCTTCGGACG ATAAAAACAA CAACAATTCC AATCTTTTAT TATTAATACT  CAACGTTGTT CTTCTTCTTG CAATTATATT GCTATTGATT CTTTACTATA ACACATCAAA AAAGCTCAAT AGAATAGTCA AAGGACACAT TAACACATTT CATGAACAAG AGAAAGATGT  TGAAACAAGT ATTGAGAAGA GGATAGAGAT AGGAGAAGGA ACAACAATGA TGACAGTAGA AGAGAGAAAG GAGTTAATGT TCTTTAAAGA TGAGACAAAA TTTCAAATGG GAGAACTTCT 
TAGAGCTTCT GCTGAGGCAT TAGGTCATGG AATTATGGGA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTGTACTTTGCTTAAGGTTGTGTTTATTTTGCTTGTTTTGGGTATTTTGAACACATTAGTGCATGGTCAAGGGACACGTGTAGGATTCTATTCAAGTACATGTTCTCAAGCAGAA
TCAATTGTTAAGTCCACAGTTACATCTCATGTTAACTCTGATTCTTCTTTGGCTCCTGGTTGTCCAAGGTTGTGACGCTTCTGTTCTCGTTGCCGGCTCAGGCACCGAGAAAACAGCATT
TCCAAACCTTGGTTTAAGAGGTTTTGAAGTTATTGAGGATGCTAAGACAAAACTCGAGGCTGCATGTCCCGGTGTTGTCTCTTGTGCCGATATCCTTTCCCTTGCTGCTCGTGATTCCGT
TGTTCTG
GTAATTAACTAAATTAACTATATATTGTACAAATGATAAATGAGATACTACTAGAAAATGTTGAATTAGTGACAAAAACATAAAATTTAGGGTTAATAGTGTTTTTCATCCCT
GTAATATATGTCATTTTTGGTTTTCGCCCCAATAACATTTAAGGTTTGATTTGCACCCTCGTAAAATTTTTATTTTCCGAAAAACACCCTTAATAGGCCATTCAAAAACAAAAATTTCTT
GAAAAAAAATTCTGAAAATGGTCTATTAGGGGTGTTTTTCAAAAAATAAAATTTTTACGAGGGTGCAAATCAAACCAAAAATTTTTTATAGGAACAAAAACCAGAAATAGCATATATTAC
AGCAGTGAAAAACACTATTAACCCTAAAATTTATTTTCATGAATTTATTCATTAATCTATTAGAACCATCAAAATTAAAGATCAATATTCAATTTTAATCAGTTCATAATTTGTTGAAAT
ATGGACCTAATTGATTTATGTATGCATTGTAGAGTGGTGGTCTTAGTTGGCAAGTTCTTACTGGACGTAGAGACGGACGCGTGTCACAGGCTTCTGACGTCAATAACTTGCCCGCTCCTA
GTGATTCTGTTGATGTGCAGAAACAAAAGTTTGCAGCAAAAGGCCTCAACACTCAAGACCTTGTCACCCTTGTTG
GTAAGCAGCGGCGAAGCTAGTAATATTTTTATTGACCACGTATAA
GGATTTTTTTTAAACTAATCTAACTTGATAGGCAAAAACAAATCACGATAACTATTACCTATATAAAATGTTCTTCATAAAATATACATTTGATTCAGCATGAACGGATTATACCAAAAA
AATGCGGCAACAGCAGATTGTATCAAAAAAACCACAGTAGAATAGTGGATTGTATCAAAAAAGCTACAACAAAAGATATAAAAACTAATAATAGCTACTTATGAAAATTGAACTCGGCGG
CCCTTCAAAGACTCAAATTCATCCATAATTGCATCTTAACTAAATGGACTTGCAATGTCTTTTTCAATGTTAATGACCAAGCTATTTGAAAGAAAATCATCACTCATTTTGTTTCATTGT
TTTGTCTTGAGATTTTTCATTGATGAGAAAGCTCGCTTTGTCGTTATGGAGACTAGGAGTGTAAAAACAAGGTGAATCAATCTATCAATTAAACAAGGCGAATCAATCTATCTACAATTG
AATCATTTTATTTGTTAAATAAAGTAAAGATTGTTATTATTTATTATTTATCTCTTTTGGGTTCTATTCTTTCAGATCCTGTACGACATGATTGAATAATTTAAAGTTTGACCGGAAGTT
AAATAAAGATGGAAAAAATTATTTCATTTAAAATAAAACTTGGGGTAGCCAAATATATATTATTAGGGGTAACTAAATATAAAAATATACCAACTCGCTCAAAAAAATATTTATTTTTGA
GGTAGCCATGGCTACCTCTTCCTTATACTAGCAACCGCCCCTGGTGGTAAGAGATCTAAATATTTTCAAAATTTATTTATCACTCTAGAATTACATATTGATGTTGCATCACATTAATTA
ATATTTTATGAATATATTATAGGTGGACATACAATTGGTACAACAGCATGTCAATTCTTCAGCAACAGATTGAGAAACTTTACTACAAATGGTGCAGCTGATCCTTCAATAGACCCTTCA
TTTCTTTCACAATTACAAACACTTTGTCCTCAAAACAGTGGTGCTACAAACAGAATTGCATTGGATACTGGAAGTCAAAATAAATTTGATAATTCTTACTATGCTAATCTGAGGAACGGA
CGTGGAATTCTTCAATCTGATCAAGCATTGTGGAATGATGCTTCCACAAAGACATTTGTGCAAAGATACTTGGGTCTAAGAGGGTTGCTTGGATTAACATTTAATGTTGAATTTGGAAAT
TCAATGGTAAAGATGAGCAACATTGGAGTGAAGACCGGTGTTGATGGTGAAATCCGCAAGATATGTTCTGCTTTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTGTACTTTGCTTAAGGTTGTGTTTATTTTGCTTGTTTTGGGTATTTTGAACACATTAGTGCATGGTCAAGGGACACGTGTAGGATTCTATTCAAGTACATGTTCTCAAGCAGAA
TCAATTGTTAAGTCCACAGTTACATCTCATGTTAACTCTGATTCTTCTTTGGCTCCTGGTTGTCCAAGGTTGTGACGCTTCTGTTCTCGTTGCCGGCTCAGGCACCGAGAAAACAGCATT
TCCAAACCTTGGTTTAAGAGGTTTTGAAGTTATTGAGGATGCTAAGACAAAACTCGAGGCTGCATGTCCCGGTGTTGTCTCTTGTGCCGATATCCTTTCCCTTGCTGCTCGTGATTCCGT
TGTTCTG
AGTGGTGGTCTTAGTTGGCAAGTTCTTACTGGACGTAGAGACGGACGCGTGTCACAGGCTTCTGACGTCAATAACTTGCCCGCTCCTAGTGATTCTGTTGATGTGCAGAAACA
AAAGTTTGCAGCAAAAGGCCTCAACACTCAAGACCTTGTCACCCTTGTTG
GTGGACATACAATTGGTACAACAGCATGTCAATTCTTCAGCAACAGATTGAGAAACTTTACTACAAATGG
TGCAGCTGATCCTTCAATAGACCCTTCATTTCTTTCACAATTACAAACACTTTGTCCTCAAAACAGTGGTGCTACAAACAGAATTGCATTGGATACTGGAAGTCAAAATAAATTTGATAA
TTCTTACTATGCTAATCTGAGGAACGGACGTGGAATTCTTCAATCTGATCAAGCATTGTGGAATGATGCTTCCACAAAGACATTTGTGCAAAGATACTTGGGTCTAAGAGGGTTGCTTGG
ATTAACATTTAATGTTGAATTTGGAAATTCAATGGTAAAGATGAGCAACATTGGAGTGAAGACCGGTGTTGATGGTGAAATCCGCAAGATATGTTCTGCTTTCAACTAA

Retrieve as FASTA