Entry information : HaAPx01 (HanXRQChr05g0133141)
Entry ID 2599
Creation 2010-05-26 (Christophe Dunand)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAPx01 (HanXRQChr05g0133141)
Name (synonym) HaAPx01 (HanXRQChr05g0133141)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation Cytosolic
Tissue type Embryos
Inducer Constitutively induced
Repressor N/D
Best BLASTp hits
Perox score E-value HaAPx01
start..stop
S start..stop
HaAPx02 498 0 1..250 1..250
HpAPx01 497 0 1..250 1..250
HargAPx01 496 0 1..250 1..250
GhyAPx01 477 1.17e-173 1..250 1..250
Gene structure Fichier Exons


exon

Literature and cross-references HaAPx01 (HanXRQChr05g0133141)
Literature Michelmore,R.W., Knapp,S., Rieseberg,L., Bradford,K., Kesseli,R., Boore,J., Kozik,A., Matvienko,M., Lavelle,D. and Lai,Z. Sunflower (Helianthus annuus) ESTs (set 2) from the Compositae Genome Project http://compgenomics.ucdavis.edu/.
DNA ref. HanXRQ genome:   HanXRQChr05 (21038441..21040643)
EST ref. GenBank:   CD854104
Cluster/Prediction ref. HanXRQ:   HanXRQChr05g0133141 UniGene:   Han.5838
Protein sequence: HaAPx01 (HanXRQChr05g0133141)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27487.92  
PI (pH):   %s   5.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKSYPCVSEEYKKAVDKARRKLRGFIADKRCAPLMLRLAWHSAGTYDVNTKSGGPFGTMRYKAELSHGANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEIAGGPEVPFHPGRE
DKEEPPVEGRLPDATKGNDHLRDVFVKTMGLDDIDIVTLSGGHTLGAAHKERSGFEGPWTSNPLVFDNSYFTELLAGEKEGLLKLPTDKALLEDPVFRPLVEKYAADEDAFFADYAVSHM
KLSELGFAEA*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 16 ESTs. Assembly by PeroxiBase Team. Strain="ANN1312".
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST