1. Browse the Database
  2. View Redoxidase
Entry information : HaAPx03 (HanXRQChr17g0544251)
Entry ID 2600
Creation 2006-01-23 (Nenad Bakalovic)
Last sequence changes 2016-04-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaAPx03 (HanXRQChr17g0544251)
Name (synonym) HaAPx03 (HanXRQChr17g0544251)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation Peroxisomal
Tissue type Germinating seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAPx03
start..stop		 S start..stop
LsaAPx02 553 0 1..285 1..285
CiAPx02 541 0 1..282 1..282
GhyAPx02 516 0 1..284 1..285
HargAPx03 508 0 1..285 1..284
Gene structure Fichier Exons►


exon

Literature and cross-references HaAPx03 (HanXRQChr17g0544251)
Literature Kozik,A. et al., Lettuce and Sunflower ESTs from the Compositae Genome Project, unpublished
DNA ref. HanXRQ genome:   HanXRQChr17 (36695910..36700995)
EST ref. GenBank:   BU032190.1 Heliagene:   HaT13l001732
Cluster/Prediction ref. HanXRQ:   HanXRQChr17g0544251 UniGene:   Han.4445
Protein sequence: HaAPx03 (HanXRQChr17g0544251)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   285 (262)
PWM (Da):   %s   31302.16 (28022.1) Transmb domain:   %s   o256-278i
PI (pH):   %s   6.64 (6.62) Peptide Signal:   %s   cut: 20 range:20-281
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMPIVDTEYLKQIDKARRELRAFIANKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRTEEEYSHGSNNGLKIAIDFEEIKSKHPRITYADLYLAGVVAVEVTGGPTVDFVPGRQDSTVSPKEGRLPNATKGAPHLRDIFYRMGLSDKDIVALSGG
HTGRAHPERSGFEGPWTREPLKFDNSYFIELLKGESEGLLKLPTDIALLDDPAFRPYVDLYADEDAFFNDYALSHKKLSELGFTPSSKTVIKDGVVLAQSAVGVLVTAAVVILSYLYEAR
KKTK*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 10 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST