Entry information : HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Entry ID 2652
Creation 2005-12-25 (Marcia Pinheiro Margis)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Name (synonym) HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue types Buds
Hypocotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx07
start..stop
S start..stop
LeGPx08 270 1.08e-94 1..164 1..167
NtGPx08-1A 269 2.84e-94 1..167 1..170
StGPx08 269 5.08e-94 1..164 1..167
PtGPx08 263 7.78e-92 1..166 1..169
Gene structure Fichier Exons


exon

Literature and cross-references HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Literature Roeckel-Drevet,P., Gagne,G., Tourvielle de Labrouhe,D.,Dufaure,J.P., Nicolas,P. and Drevet,J.R. Molecular characterization, organ distribution and stress-mediated nduction of two glutathione peroxidase-encoding mRNAs in sunflower (Helianthus annuus). Physiol. Plantarum 103, 385-394 (1998)
Protein ref. UniProtKB:   O23970
DNA ref. HanXRQ genome:   HanXRQChr03 (146707950..146711198)
mRNA ref. GenBank:   Y14429
Cluster/Prediction ref. HanXRQ:   HanXRQChr03g0086581 UniGene:   Han.862
Protein sequence: HaGPx07 (HanXRQChr03g0086581/GPXHA-1 / HaGPx06-2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18720.52  
PI (pH):   %s   4.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAQPKKTLYDFTVKDAKGNDVDLSVYKGKVVLIVNVASKCGLTNNNYDELNQIYLKYKEGFEILAFPCNQFGAQEPGTNEEIVDFVCTKFKSEFPIFDIDVNGENAAPVYEFLKTGFYG
ILGGDIQWNFSKFLVDKNGQPVDRYYPTTSPLTVE
RDIQKLLGLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 1 mRNA and 3 ESTs. Cultivar="Emil" and "psc8".
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST