Entry information : SbPrx48 (Sobic.002G416800.1 [2.1] / SB02G042870 [1.4])
Entry ID 2727
Creation 2010-01-05 (Christophe Dunand)
Last sequence changes 2010-01-05 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx48 (Sobic.002G416800.1 [2.1] / SB02G042870 [1.4])
Name (synonym) SbPrx48 (Sobic.002G416800.1 [2.1] / SB02G042870 [1.4])
Class Class III peroxidase    [Orthogroup: Prx077]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx48
start..stop
S start..stop
BdiPrx07 500 1.5e-180 1..321 1..320
SiPrx128 496 9.63e-179 28..321 26..318
TaPrx01-1A 495 1.14e-178 1..321 1..316
HvPrx63 494 2.88e-178 1..321 1..316
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2727' 'join(76602165..76602374,76602492..76602683,76602776..76602941,76603063..76603460)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76602165..76602374 208 N° 2 76602492..76602683 190 N° 3 76602776..76602941 164 N° 4 76603063..76603460 396
join(76602165..76602374,76602492..76602683,76602776..76602941,76603063..76603460 )


exon

Literature and cross-references SbPrx48 (Sobic.002G416800.1 [2.1] / SB02G042870 [1.4])
Literature Plant Genome Database.
DNA ref. Phytozome 12:   chromosome_2 (76602165..76603460)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.3513.1
Protein sequence: SbPrx48 (Sobic.002G416800.1 [2.1] / SB02G042870 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   33368.44 (31099.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.76 (6.76) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESSSRLSLLVVAILALATAATAQLSSTFYDTSCPKALATIKSAV
TAAVNNEARMGASLLRLHFHDCFVD
GCDASVLLADTGSFTGEQGAIPNKNSLRGFSVIDSIKTQVEAVCNQTVSCADILAVAARDSVVALGGPSWTVLVGRRDSTTASKDNAERDLPPPSFDLANLTRSFANKNLSVTDMVALSG
GHTIGQAQCRFFRDHIYNDTNINSAFAASLQANCPRPANGSGDSTLAPLDAASPTAFDNAYFSNLMSHKGLLHSDQQLFNGGSTDSTVRSFASSASAFSNAFATAMVNMGNIAPKTGSQG
QIRVTCSKVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCGTCTTCTCGCCTCAGCTTGCTTGTGGTCGCGATCTTGGCGCTGGCCACGGCGGCCACCGCGCAGCTGTCGTCGACGTTCTACGACACGTCGTGTCCCAAGGCTCTGGCCACC
ATCAAGAGCGCGGTGACGGCCGCGGTTAACAACGAGGCCCGCATGGGCGCTTCCCTGCTCAGGCTGCACTTCCATGACTGCTTCGTTGAT
ATGCAAGTCTCGAGACTCTCGCTCTCGCAT
GGATCTTTGAAAAATTGCAGTCACACATCTAGTACGCGTGGATTATGCATGTGACCAGATTTCACTACGTGTGGTGTGTGACTGTGCAGGGCTGTGACGCATCTGTTCTGCTGGCGGACA
CGGGGAGCTTCACCGGCGAGCAGGGGGCGATTCCGAACAAGAACTCGCTGAGAGGCTTCAGCGTCATCGACAGTATCAAGACGCAGGTGGAGGCCGTGTGCAACCAGACCGTCTCCTGCG
CTGACATCCTCGCCGTCGCCGCCCGTGACTCCGTCGTGGCG
CGGTAAGTTTTTACTTATATGATAGGTAGGTAGATAGTTGTGTGCATAGCTAGGATGATCGATAGAGGTTTACTGGAAC
TCGATCTGCATGCAGCTGGGAGGGCCGTCATGGACTGTTCTTGTAGGAAGAAGGGACTCCACCACTGCAAGCAAGGACAATGCAGAACGAGACCTGCCACCTCCTTCTTTCGATCTCGCC
AACCTCACCCGGTCATTCGCAAACAAGAATCTCAGCGTCACCGACATGGTTGCTCTCTCGG
GGGTAAGTACGTAGGATATGCCTACTACCATTCATTCATACGTCTGCATGCGTGCCTGC
ACGAAGACGTGCTCTGACGATCGAGGACAACACAAGCGATGCAAGCAAATATGATGCATTGCAGGGGGGCACACGATCGGGCAGGCGCAGTGCCGCTTCTTCCGCGACCACATCTACAAC
GACACCAACATCAACTCCGCATTCGCGGCGTCGCTGCAGGCCAACTGCCCCCGGCCGGCCAACGGCAGCGGCGACTCCACGCTGGCGCCGCTGGACGCGGCGTCGCCCACCGCATTCGAC
AACGCCTACTTCAGCAACCTGATGTCGCATAAGGGCCTCCTGCACTCCGACCAGCAGCTCTTCAACGGCGGCAGCACGGATAGCACGGTCAGGAGCTTCGCGTCCAGCGCGTCCGCCTTC
AGCAACGCCTTCGCGACGGCCATGGTGAACATGGGGAACATCGCCCCCAAGACAGGGTCCCAGGGACAGATAAGGGTCACCTGCTCCAAGGTCAACTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTCGTCTTCTCGCCTCAGCTTGCTTGTGGTCGCGATCTTGGCGCTGGCCACGGCGGCCACCGCGCAGCTGTCGTCGACGTTCTACGACACGTCGTGTCCCAAGGCTCTGGCCACC
ATCAAGAGCGCGGTGACGGCCGCGGTTAACAACGAGGCCCGCATGGGCGCTTCCCTGCTCAGGCTGCACTTCCATGACTGCTTCGTTGAT
GGCTGTGACGCATCTGTTCTGCTGGCGGAC
ACGGGGAGCTTCACCGGCGAGCAGGGGGCGATTCCGAACAAGAACTCGCTGAGAGGCTTCAGCGTCATCGACAGTATCAAGACGCAGGTGGAGGCCGTGTGCAACCAGACCGTCTCCTGC
GCTGACATCCTCGCCGTCGCCGCCCGTGACTCCGTCGTGGCG
CTGGGAGGGCCGTCATGGACTGTTCTTGTAGGAAGAAGGGACTCCACCACTGCAAGCAAGGACAATGCAGAACGAGAC
CTGCCACCTCCTTCTTTCGATCTCGCCAACCTCACCCGGTCATTCGCAAACAAGAATCTCAGCGTCACCGACATGGTTGCTCTCTCGG
GGGGGCACACGATCGGGCAGGCGCAGTGCCGC
TTCTTCCGCGACCACATCTACAACGACACCAACATCAACTCCGCATTCGCGGCGTCGCTGCAGGCCAACTGCCCCCGGCCGGCCAACGGCAGCGGCGACTCCACGCTGGCGCCGCTGGAC
GCGGCGTCGCCCACCGCATTCGACAACGCCTACTTCAGCAACCTGATGTCGCATAAGGGCCTCCTGCACTCCGACCAGCAGCTCTTCAACGGCGGCAGCACGGATAGCACGGTCAGGAGC
TTCGCGTCCAGCGCGTCCGCCTTCAGCAACGCCTTCGCGACGGCCATGGTGAACATGGGGAACATCGCCCCCAAGACAGGGTCCCAGGGACAGATAAGGGTCACCTGCTCCAAGGTCAAC
TCCTAA

Retrieve as FASTA