Entry information : SbPrx67 (Sobic.003G320800.1 [2.1] / Sb03g036760 [1.4])
Entry ID 2744
Creation 2008-11-17 (Christophe Dunand)
Last sequence changes 2011-01-21 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx67 (Sobic.003G320800.1 [2.1] / Sb03g036760 [1.4])
Name (synonym) SbPrx67 (Sobic.003G320800.1 [2.1] / Sb03g036760 [1.4])
Class Class III peroxidase    [Orthogroup: Prx175]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx67
start..stop
S start..stop
ZmPrx124 571 0 30..348 25..342
SiPrx13 526 0 23..348 17..343
OsPrx19 477 1.08e-170 10..348 3..336
TaPrx167-1A 469 1.3e-167 17..348 13..335
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2744' 'complement(join(64842359..64842949,64843056..64843241,64843406..64843675))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64843406..64843675 268 N° 2 64843056..64843241 184 N° 3 64842359..64842949 589  
complement(join(64842359..64842949,64843056..64843241,64843406..64843675))


exon

Literature and cross-references SbPrx67 (Sobic.003G320800.1 [2.1] / Sb03g036760 [1.4])
Literature JGI
DNA ref. Phytozome 12:   chromosome_3 (64843675..64842359)
Protein sequence: SbPrx67 (Sobic.003G320800.1 [2.1] / Sb03g036760 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (319)
PWM (Da):   %s   37501.6 (34430.9)  
PI (pH):   %s   4.95 (4.68) Peptide Signal:   %s   cut: 30 range:30-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALRQQQQQLLVVVVVAAVVVASCRPGRADPAAMSVLPGLPVAGL
AVGFYNESCPQVEDLVLAEMQSLVGKDKTIGPALLRFMFHDCLVR
GCDASIMLISRNKTGERDAIPSYGLRGYDEIEHIKAKVEDACPLTVSCADIIIMAARDAVYLSNGPRYAVETGRRDGKVSLDCDANNDLPPPSSAIVDLKTYFSFKGLGWKDLVVLSGSH
TIGRAQCSTFASDRLYNYSGRVAQDPSLNKTYAAHLRELCEPGVANDAAMVEMDPSSPYTFDLSYYRAVRGNTGLFTSDQALLDDPWTRAYVERMAAAGASTDEFFADYAAAMTNMGRIE
VLTGDNGEIRKVCAAHVD*

Retrieve as FASTA  
Remarks Complete Sequence from genomic (chromo 3, 3 introns) and no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGAGGCAGCAGCAGCAGCAGCTGCTGGTGGTGGTGGTCGTGGCGGCCGTCGTCGTCGCGAGCTGCCGGCCGGGCCGCGCGGACCCGGCCGCGATGAGCGTGCTGCCGGGCCTC
CCCGTCGCCGGCCTCGCGGTGGGGTTCTACAACGAGTCGTGCCCGCAGGTCGAGGACCTGGTGCTCGCCGAGATGCAGAGCCTCGTCGGCAAGGACAAGACCATCGGGCCGGCGCTGCTG
CGGTTCATGTTCCACGACTGCCTCGTCCGG
GTGCGTTTTGCTACCTCTAGTCTTTTCTCTAGCTTTCTCGTCGTCGTCGCTCCGTACTCCTCGTCTCGCGTGCCTGCGTGTCCCCTCGAT
CGATCGCGTGTACTGCACCGGTGATCTCGCTCGCGGTGATCGGGTGGTTGATGGCAGTTTTGCGTCGCGTGCAGGGGGCTGCGACGCGTCGATCATGCTCATCTCCCGGAACAAGACCGG
GGAGCGGGACGCCATCCCGAGCTACGGCCTCCGCGGCTACGACGAGATCGAGCACATCAAGGCCAAGGTGGAGGACGCGTGCCCGCTGACCGTGTCGTGCGCGGACATCATCATCATGGC
GGCCCGGGACGCCGTGTACCTG
GTAATAATAATCAGCCTCTCCCTTTGTCGTCGGCCTTGGTGAAAATCAATGCACTCGTGAGCTCGATCGAGGGCACATTGAAGCGGCTTCGTTCTCCT
TGTTCCAGAGAGCAACGGGCCGCGGTATGCTGTGGAGACCGGCCGCCGCGACGGCAAGGTGTCGTTGGACTGCGACGCCAACAACGACCTCCCGCCGCCGTCCTCCGCAATCGTCGACCT
CAAGACCTACTTCAGCTTCAAGGGATTGGGCTGGAAGGACCTGGTGGTGCTGTCAGGAAGCCACACGATCGGGAGGGCGCAGTGCTCGACGTTCGCGTCGGACAGGCTGTACAACTACAG
CGGGCGCGTGGCGCAGGACCCGTCGCTGAACAAGACGTACGCGGCGCACCTGCGGGAGCTGTGCGAGCCGGGCGTCGCCAACGACGCCGCCATGGTGGAGATGGACCCGAGCAGCCCCTA
CACGTTCGACCTGAGCTACTACCGCGCCGTGCGCGGCAACACGGGGCTCTTCACGTCGGACCAGGCCCTCCTCGACGACCCGTGGACCAGGGCGTACGTGGAGCGGATGGCCGCCGCGGG
GGCGTCCACCGACGAGTTCTTCGCCGACTACGCGGCCGCCATGACCAACATGGGCCGGATCGAGGTGCTCACGGGGGACAACGGGGAGATCAGGAAGGTCTGCGCCGCGCACGTTGACTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGAGGCAGCAGCAGCAGCAGCTGCTGGTGGTGGTGGTCGTGGCGGCCGTCGTCGTCGCGAGCTGCCGGCCGGGCCGCGCGGACCCGGCCGCGATGAGCGTGCTGCCGGGCCTC
CCCGTCGCCGGCCTCGCGGTGGGGTTCTACAACGAGTCGTGCCCGCAGGTCGAGGACCTGGTGCTCGCCGAGATGCAGAGCCTCGTCGGCAAGGACAAGACCATCGGGCCGGCGCTGCTG
CGGTTCATGTTCCACGACTGCCTCGTCCGG
GGCTGCGACGCGTCGATCATGCTCATCTCCCGGAACAAGACCGGGGAGCGGGACGCCATCCCGAGCTACGGCCTCCGCGGCTACGACGAG
ATCGAGCACATCAAGGCCAAGGTGGAGGACGCGTGCCCGCTGACCGTGTCGTGCGCGGACATCATCATCATGGCGGCCCGGGACGCCGTGTACCTG
AGCAACGGGCCGCGGTATGCTGTG
GAGACCGGCCGCCGCGACGGCAAGGTGTCGTTGGACTGCGACGCCAACAACGACCTCCCGCCGCCGTCCTCCGCAATCGTCGACCTCAAGACCTACTTCAGCTTCAAGGGATTGGGCTGG
AAGGACCTGGTGGTGCTGTCAGGAAGCCACACGATCGGGAGGGCGCAGTGCTCGACGTTCGCGTCGGACAGGCTGTACAACTACAGCGGGCGCGTGGCGCAGGACCCGTCGCTGAACAAG
ACGTACGCGGCGCACCTGCGGGAGCTGTGCGAGCCGGGCGTCGCCAACGACGCCGCCATGGTGGAGATGGACCCGAGCAGCCCCTACACGTTCGACCTGAGCTACTACCGCGCCGTGCGC
GGCAACACGGGGCTCTTCACGTCGGACCAGGCCCTCCTCGACGACCCGTGGACCAGGGCGTACGTGGAGCGGATGGCCGCCGCGGGGGCGTCCACCGACGAGTTCTTCGCCGACTACGCG
GCCGCCATGACCAACATGGGCCGGATCGAGGTGCTCACGGGGGACAACGGGGAGATCAGGAAGGTCTGCGCCGCGCACGTTGACTAG

Retrieve as FASTA