Entry information : MePrx09 (cassava4.1_010796m / MecPX2)
Entry ID 280
Creation 2010-04-21 (Christophe Dunand)
Last sequence changes 2011-11-25 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx09 (cassava4.1_010796m / MecPX2)
Name (synonym) MePrx09 (cassava4.1_010796m / MecPX2)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue types Seedlings
Stems
Inducers Pathogen interaction
Xanthomonas infection
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx09
start..stop
S start..stop
RcPrx47 582 0 16..351 19..353
EcPrx01 563 0 7..351 5..347
RcPrx11 562 0 16..351 20..354
PtPrx67 512 0 7..341 11..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1043765..1044001 237 N° 2 1043078..1043272 195 N° 3 1042363..1042986 624  
complement(join(1042363..1042986,1043078..1043272,1043765..1044001))


exon

Literature and cross-references MePrx09 (cassava4.1_010796m / MecPX2)
Literature REFERENCE 1 Reilly,K., Han,Y., Tohme,J. and Beeching,J.R. Cassava peroxidase expressed during post-harvest physiological deterioration Unpublished.

REFERENCE 2 Lopez,C., Jorge,V., Piegu,B., Mba,C., Cortes,D., Restrepo,S., Soto ,M., Laudie,M., Berger,C., Cooke,R., Delseny,M., Tohme,J. and Verdier,V. A unigene catalogue of 5700 expressed genes in cassava. Plant Mol. Biol. 56 (4), 541-554 (2004).
Protein ref. UniProtKB:   Q94IP4
DNA ref. Phytozome 12:   scaffold06814 (1044001..1042363)
mRNA ref. GenBank:   AY033386.1
Protein sequence: MePrx09 (cassava4.1_010796m / MecPX2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (331)
PWM (Da):   %s   38446.63 (36294.5)  
PI (pH):   %s   7.88 (7.70) Peptide Signal:   %s   cut: 21 range:21-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIFSLLLISCILVASCFAAIEAQKRPPIVNGLSWNFYKTSCPKVESIIKNELKKVFKKDIGQAAGVLRIQFHDCFVQGCDGSVLLDGSAGGPSEKSELPNLTLRKEAFKIINDLRDAVHKQCGRVVSCSDIVAIAARDSVVLTGGPDYDVPLGRRDGVVFAQVNQTFIDLVGPDANTTTILTKLARKNLDATDAVALSGAHTIGIGHCTSFTDRLYPTQDPTLDKTFANNLKRTCPKVDTTNTTFLDLRSPNKFDNKYFVDLMNRQGLFTSDQDLYEDRRTRGIVTSFAVNESLFFEKFVLSMIKMGQLNVLTGKQGEIRANCSARNSNKEYLASVAEEENMGSSAEMR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2), 6 ESTs (CK644832, CK643183, CK645481, CK641715, CK641645, CK645617), mRNA (AY033386).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGAATCTTTTCTCTCCTTTTGATCTCTTGTATTTTGGTTGCTTCTTGCTTTGCTGCCATTGAAGCACAAAAGAGACCTCCTATAGTGAATGGTCTCTCATGGAATTTCTACAAA
ACTAGTTGCCCTAAAGTTGAATCCATCATAAAAAATGAACTCAAGAAAGTTTTCAAGAAGGATATTGGTCAAGCTGCTGGCGTTCTTCGTATACAGTTCCACGACTGCTTCGTTCAG
GTA
ACTATCCTTTCATTCTTCTTCTCAATAGCCTAAATCTTCTTGATCCATCCTTCAGTAAGTAGATCGAACTAGTTCTTGATTTTTAGCAGTTGATTCTTCCCTTTGCCAGTTTCTAGTACG
TACATGCATGGCTGTCCAATAATTGCTTTGTTTAATATGAGCTGTGAAGCATGATGCTTCCTCTTTTGTTAATTTTGCTGATTCTTTACCCAGTTTTGCTTTCCTTTTCTGGCCTGGCAT
GTTTTTTTAACAGAGGCTCTCTCTGCTTAAGCTTGCCTTTTGTTTAATGCTTTTGTTAATCTTTTAGATTTTTTAAAAAAAAAAGACATCTTCGATCGTGATGTGCTAAGCATGACATGA
CTGTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATCTAAATACATAATTTCTCTGTGTTGCTTTAAAAAAAAAAAAACTCTGATCGTTGTTA
ACGTCTCAGGGATGCGATGGCTCGGTGCTGCTTGATGGATCAGCAGGCGGACCAAGCGAGAAATCTGAACTTCCGAACTTGACTTTGAGAAAAGAGGCATTTAAAATCATCAACGACCTC
CGCGATGCTGTCCACAAGCAGTGTGGCCGTGTCGTTTCTTGCTCTGACATCGTCGCCATCGCCGCCCGTGACTCCGTTGTCTTG
GTAAATTGTCCAGCTTTTGTTAATCTATCAGTCTTA
AAGTCTAAAGTTGTTTTCCATCGTCTGATCGTTTCGTTTCTTTTGTGGGTTGCAGACCGGCGGTCCTGACTACGATGTCCCCTTAGGAAGGCGAGACGGTGTCGTATTTGCTCAAGTAAA
CCAAACTTTTATCGACCTGGTAGGACCTGATGCTAACACTACTACCATCCTCACCAAGCTTGCCCGGAAAAATCTTGACGCCACCGATGCGGTGGCCCTCTCAGGCGCCCACACCATCGG
CATTGGCCACTGCACATCTTTCACTGACCGTCTTTATCCAACCCAAGATCCTACCTTGGACAAAACATTTGCCAACAATCTCAAGCGAACTTGTCCAAAAGTAGACACCACCAACACAAC
TTTCTTGGATCTTAGGTCTCCTAACAAATTTGACAATAAATACTTCGTTGATCTCATGAACCGTCAAGGTCTTTTTACCTCGGACCAAGATTTGTACGAGGATAGGAGAACAAGGGGCAT
TGTCACTAGCTTTGCTGTTAATGAATCATTGTTCTTTGAGAAATTTGTGCTTTCCATGATCAAGATGGGGCAACTGAACGTGTTGACAGGGAAACAAGGAGAAATTCGTGCCAATTGCTC
TGCTAGGAATTCTAACAAAGAGTATTTGGCGTCCGTCGCAGAAGAGGAGAACATGGGATCATCTGCTGAAATGAGATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGAATCTTTTCTCTCCTTTTGATCTCTTGTATTTTGGTTGCTTCTTGCTTTGCTGCCATTGAAGCACAAAAGAGACCTCCTATAGTGAATGGTCTCTCATGGAATTTCTACAAA
ACTAGTTGCCCTAAAGTTGAATCCATCATAAAAAATGAACTCAAGAAAGTTTTCAAGAAGGATATTGGTCAAGCTGCTGGCGTTCTTCGTATACAGTTCCACGACTGCTTCGTTCAG
GGA
TGCGATGGCTCGGTGCTGCTTGATGGATCAGCAGGCGGACCAAGCGAGAAATCTGAACTTCCGAACTTGACTTTGAGAAAAGAGGCATTTAAAATCATCAACGACCTCCGCGATGCTGTC
CACAAGCAGTGTGGCCGTGTCGTTTCTTGCTCTGACATCGTCGCCATCGCCGCCCGTGACTCCGTTGTCTTG
ACCGGCGGTCCTGACTACGATGTCCCCTTAGGAAGGCGAGACGGTGTC
GTATTTGCTCAAGTAAACCAAACTTTTATCGACCTGGTAGGACCTGATGCTAACACTACTACCATCCTCACCAAGCTTGCCCGGAAAAATCTTGACGCCACCGATGCGGTGGCCCTCTCA
GGCGCCCACACCATCGGCATTGGCCACTGCACATCTTTCACTGACCGTCTTTATCCAACCCAAGATCCTACCTTGGACAAAACATTTGCCAACAATCTCAAGCGAACTTGTCCAAAAGTA
GACACCACCAACACAACTTTCTTGGATCTTAGGTCTCCTAACAAATTTGACAATAAATACTTCGTTGATCTCATGAACCGTCAAGGTCTTTTTACCTCGGACCAAGATTTGTACGAGGAT
AGGAGAACAAGGGGCATTGTCACTAGCTTTGCTGTTAATGAATCATTGTTCTTTGAGAAATTTGTGCTTTCCATGATCAAGATGGGGCAACTGAACGTGTTGACAGGGAAACAAGGAGAA
ATTCGTGCCAATTGCTCTGCTAGGAATTCTAACAAAGAGTATTTGGCGTCCGTCGCAGAAGAGGAGAACATGGGATCATCTGCTGAAATGAGATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTAGACACA CGACACAACA CACACCAGCC ATGGCTAGAA TCTTTTCTCT CCTTTTGATC TCTTGTATTT TGGTTGCTTC TTGCTTTGCT GCCATTGAAG CACAAAAGAG ACCTCCTATA  GTGAATGGTC TCTCATGGAA TTTCTACAAA ACTAGTTGCC CTAAAGTTGA ATCCATCATA AAAAATGAAC TCAAGAAAGT TTTCAAGAAG GATATTGGTC AAGCTGCTGG CGTTCTTCGT  ATACAGTTCC ACGACTGCTT CGTTCAGGGA TGCGATGGCT CGGTGCTGCT TGATGGATCA GCAGGCGGAC CAAGCGAGAA ATCTGAACTT CCGAACTTGA CTTTGAGAAA AGAGGCATTT  AAAATCATCA ACGACCTCCG CGATGCTGTC CACAAGCAGT GTGGCCGTGT CGTTTCTTGC TCTGACATCG TCGCCATCGC CGCCCGTGAC TCCGTTGTCT TGACCGGCGG TCCTGACTAC  GATGTCCCCT TAGGAAGGCG AGACGGTGTC GTATTTGCTC AAGTAAACCA AACTTTTATC GACCTGGTAG GACCTGATGC TAACACTACT ACCATCCTCA CCAAGCTTGC CCGGAAAAAT  CTTGACGCCA CCGATGCGGT GGCCCTCTCA GGCGCCCACA CCATCGGCAT TGGCCACTGC ACATCTTTCA CTGACCGTCT TTATCCAACC CAAGATCCTA CCTTGGACAA AACATTTGCC  AACAATCTCA AGCGAACTTG TCCAAAAGTA GACACCACCA ACACAACTTT CTTGGATCTT AGGTCTCCTA ACAAATTTGA CAATAAATAC TTCGTTGATC TCATGAACCG TCAAGGTCTT  TTTACCTCGG ACCAAGATTT GTACGAGGAT AGGAGAACAA GGGGCATTGT CACTAGCTTT GCTGTTAATG AATCATTGTT CTTTGAGAAA TTTGTGCTTT CCATGATCAA GATGGGGCAA  CTGAACGTGT TGACAGGGAA ACAAGGAGAA ATTCGTGCCA ATTGCTCTGC TAGGAATTCT AACAAAGAGT ATTTGGCGTC CGTCGCAGAA GAGGAGAACA TGGGATCATC TGCTGAAATG  AGATAAAGAA GTGCATTACT GTAACGGGTA GCTGTTTTTT TTTTTGGTGC CGTGACTTGT TTTTGTACCA AACATGTTGT CTTCTTGTTA GTAAACCTGC TGTCTCTGTA ACAATAAAGT 
ATTGAATGAC TAATTAATAA TATTGGAGAC CAAGAGCCAT CGATCTTATT TTATCAAATG GTGAGATGGA ATAGTGTAAA TTTTTATTCG GTGATTAGAA GTATTCGATT T 

Retrieve as FASTA