Entry information : MtPrx91 (Medtr8g062780.1[4.0]Medtr8g073980.1[3.0])
Entry ID 2810
Creation 2006-06-22 (Christophe Dunand)
Last sequence changes 2006-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx91 (Medtr8g062780.1[4.0]Medtr8g073980.1[3.0])
Name (synonym) MtPrx91 (Medtr8g062780.1[4.0]Medtr8g073980.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx91
start..stop
S start..stop
GmPrx173 493 2e-177 10..327 5..322
GmPrx[P]303 465 1e-166 17..327 12..322
CroPrx42 438 1e-155 8..327 6..331
PtPrx15 435 2e-154 10..324 12..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26258096..26258602 507 N° 2 26257328..26257810 483  
complement(join(26257328..26257810,26258096..26258602))


exon

Literature and cross-references MtPrx91 (Medtr8g062780.1[4.0]Medtr8g073980.1[3.0])
Literature Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D. and Roe,B.A. Medicago truncatula BAC Clone mth2-145c3.
Protein ref. UniProtKB_Uniparc:   Q1SAT8
DNA ref. Phytozome 12:   chr8 (26258602..26257328)
Cluster/Prediction ref. Phytozome Gene 12:   31072722
Omic ref. Gene atlas:   Mtr.14150.1.S1_at
Protein sequence: MtPrx91 (Medtr8g062780.1[4.0]Medtr8g073980.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (308)
PWM (Da):   %s   36519.05 (34086.8)  
PI (pH):   %s   7.22 (6.74) Peptide Signal:   %s   cut: 22 range:22-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIYKSYIFSLLCLALFPITQSKLIPNYYQKSCPKFEDIVKQTVTDKQKTTPSTAGAALRLFFSDCMIGGCDASVLVSSNSFNKAERDADINLSLSGDGFEVVTRAKNMLELECPGVVSCADILAAAARDLVVSVGGPFYELDLGRRDSLESKSIDAENKYPLPTMTNSQVIDIFTSKGFTVQEMVALAGAHTIGFSHCKQFSNRLFNFSKTTETDPKYNPEYAAGLKKLCQNYQKDTSMSAFNDVMTPSKFDNMYFKNLKRGMGLLATDSLMGEDKRTKPFVDMYAENQTKFFEDFGNAMRKLSVLHVKEGKDGEIRNRCDTFNNLNAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8 and 2 exons). No EST. Also found in two other contigs AC146588 and AC174365.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTATAAATCTTACATTTTCTCCTTATTATGCCTAGCCTTATTTCCAATTACACAATCGAAACTCATTCCAAACTACTACCAAAAATCATGTCCTAAATTTGAAGACATCGTCAAG
CAAACCGTAACTGATAAGCAGAAAACAACACCTTCAACCGCTGGCGCTGCACTCCGCCTCTTCTTCAGCGATTGCATGATTGGAGGTTGTGATGCATCTGTCCTAGTATCCTCCAATTCC
TTCAACAAGGCAGAACGTGATGCCGACATCAACCTCTCCCTCTCAGGAGACGGTTTTGAGGTCGTCACACGAGCAAAGAACATGTTGGAGCTGGAATGCCCCGGTGTGGTCTCTTGTGCT
GACATACTTGCTGCAGCGGCACGTGACCTTGTTGTCAGTGTTGGCGGTCCATTTTACGAGTTAGACCTTGGTCGAAGAGACAGTTTAGAGTCCAAATCAATCGACGCAGAAAACAAATAT
CCATTGCCAACCATGACCAATTCTCAG
GTAAAAAAAAACAAATCTATTACATTGTTCAATAATTTTTTTTACTAAACACTGAAATTACAAAATTCATCGTTGAATTGAAAATCATTCAAT
ATGTGAGTACAATACATTAAAATTAGCGTCATATAATAATAATATGATCATGAAACATATGATACAAATTTTTAATCAAATTGTGATTTTTGTAATACAATAAAAAAGTTATCGAACCTT
TGTAACATTAACCAAATACTTCATCCTTCTACATTGAATTGTTGACATAAATATTTTATGTAACCATGCTAGGTGATAGACATTTTCACTTCAAAAGGGTTTACAGTTCAAGAGATGGTG
GCTCTAGCAGGTGCACACACGATAGGATTCTCTCACTGCAAACAGTTTAGTAACAGGCTCTTCAACTTCAGCAAGACCACTGAAACTGATCCTAAATATAATCCAGAGTATGCTGCAGGG
CTTAAAAAACTCTGCCAAAATTACCAAAAAGATACTTCCATGTCAGCGTTCAACGACGTGATGACACCTAGCAAGTTTGATAACATGTATTTCAAGAATTTGAAGAGAGGAATGGGACTT
TTGGCTACGGATAGTTTGATGGGTGAGGACAAGAGGACTAAACCATTTGTGGATATGTATGCTGAAAATCAAACCAAGTTCTTTGAGGATTTTGGTAATGCTATGCGTAAGCTTAGTGTT
TTGCATGTTAAAGAGGGGAAGGATGGAGAGATACGAAATAGGTGTGATACTTTCAACAATCTTAATGCTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTATAAATCTTACATTTTCTCCTTATTATGCCTAGCCTTATTTCCAATTACACAATCGAAACTCATTCCAAACTACTACCAAAAATCATGTCCTAAATTTGAAGACATCGTCAAG
CAAACCGTAACTGATAAGCAGAAAACAACACCTTCAACCGCTGGCGCTGCACTCCGCCTCTTCTTCAGCGATTGCATGATTGGAGGTTGTGATGCATCTGTCCTAGTATCCTCCAATTCC
TTCAACAAGGCAGAACGTGATGCCGACATCAACCTCTCCCTCTCAGGAGACGGTTTTGAGGTCGTCACACGAGCAAAGAACATGTTGGAGCTGGAATGCCCCGGTGTGGTCTCTTGTGCT
GACATACTTGCTGCAGCGGCACGTGACCTTGTTGTCAGTGTTGGCGGTCCATTTTACGAGTTAGACCTTGGTCGAAGAGACAGTTTAGAGTCCAAATCAATCGACGCAGAAAACAAATAT
CCATTGCCAACCATGACCAATTCTCAG
GTGATAGACATTTTCACTTCAAAAGGGTTTACAGTTCAAGAGATGGTGGCTCTAGCAGGTGCACACACGATAGGATTCTCTCACTGCAAACAG
TTTAGTAACAGGCTCTTCAACTTCAGCAAGACCACTGAAACTGATCCTAAATATAATCCAGAGTATGCTGCAGGGCTTAAAAAACTCTGCCAAAATTACCAAAAAGATACTTCCATGTCA
GCGTTCAACGACGTGATGACACCTAGCAAGTTTGATAACATGTATTTCAAGAATTTGAAGAGAGGAATGGGACTTTTGGCTACGGATAGTTTGATGGGTGAGGACAAGAGGACTAAACCA
TTTGTGGATATGTATGCTGAAAATCAAACCAAGTTCTTTGAGGATTTTGGTAATGCTATGCGTAAGCTTAGTGTTTTGCATGTTAAAGAGGGGAAGGATGGAGAGATACGAAATAGGTGT
GATACTTTCAACAATCTTAATGCTAATTGA

Retrieve as FASTA