Entry information : MtPrx94 (Medtr4g030890.1[4.0] / / Medtr4g031060.1 and Medtr4g030890.1 [3.5] / Medtr4g032010.1[3.0])
Entry ID 2824
Creation 2006-03-03 (Christophe Dunand)
Last sequence changes 2013-12-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-29 (Christophe Dunand)
Peroxidase information: MtPrx94 (Medtr4g030890.1[4.0] / / Medtr4g031060.1 and Medtr4g030890.1 [3.5] / Medtr4g032010.1[3.0])
Name (synonym) MtPrx94 (Medtr4g030890.1[4.0] / / Medtr4g031060.1 and Medtr4g030890.1 [3.5] / Medtr4g032010.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Coleoptiles
Roots
Inducer Methyl jasmonate treatment
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx94
start..stop
S start..stop
MtPrx95 576 0 68..415 1..343
LjPrx33 564 0 68..403 1..335
GmPrx48 563 0 78..413 5..342
PvPrx17 559 0 86..415 19..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10498450..10498884 435 N° 2 10499610..10499801 192 N° 3 10500264..10500884 621  
join(10498450..10498884,10499610..10499801,10500264..10500884)


exon

Literature and cross-references MtPrx94 (Medtr4g030890.1[4.0] / / Medtr4g031060.1 and Medtr4g030890.1 [3.5] / Medtr4g032010.1[3.0])
Literature Achnine,L., He,X.-Z., Scott,A.D., May,G.D. and Dixon,R.A. Medicago truncatula Methyl Jasmonate-Elicited Root Cell Suspension Culture Expressed Sequence Tags from the Samuel Roberts Noble Foundation - Center for Medicago Genomics Research.
DNA ref. Phytozome 12:   chr4 (10498450..10500884)
EST ref. GenBank:   DY616897
Cluster/Prediction ref. Phytozome Gene 12:   31114039
Omic ref. Gene atlas:   Mtr.6992.1.S1_at
Protein sequence: MtPrx94 (Medtr4g030890.1[4.0] / / Medtr4g031060.1 and Medtr4g030890.1 [3.5] / Medtr4g032010.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   415
PWM (Da):   %s   46191.42 Transmb domain:   %s   i71-93o
PI (pH):   %s   9.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGNIIAKLSTNYCMTHSTIAHSIFSSTIKYPSNQRGKLQNLMSSVSSFHTTNKHTHSSKQNNKRSTMFQIPNNRPIITMFLFLIFIINIITVTSSSSDLRPGFYSKTCPKAETIVRDVMRKALIREPRSVASVMRLQFHDCFVNGCDGSVLLDDTPTMLGEKLALSNINSLRSFEVVDEVKEALEKACPGVVSCADIIIMASRDAVALTGGPDWEVRLGRLDSLTASQEDSDNIMPSPRANASTLIDLFQRFNLTVKDLVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALDPAFRLELDKLCPLDVDQNKTGNLDSTPVIFDNQYFKDLVGGRGFLNSDQTLFTYPQTKGLVRFYSRDQSEFFKAFVKGMLKMGDLQSGRPGEVRRNCRVVNDRFAYVLFQHKMQKNVKSI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2) and 4 ESTs (DY616897, DY616721, DW018611, CX533163). Contains a very long PS.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGGGCGTCA ACTTTGCAGA TCCGTAAGCA TGGGTATTTC GGTGAGTTAG GTTTTATCAT ATTATTTGTA GGCATTTTGC TGTCGTATGC TATTAACTTG GGTGCTTTGA GTTTGTTCGC  AGATTCATCC TTTAACGTTT TTAGCGATAT TTGTATTTGA TATACTCTAT CAATTTGAAT GAATGAATAT CGTTTTAATT TTGTCAAAAA AAAAATCGTG GGAAAGTTCA AGAATATTGA  GCATCTTCCA AGAGGGAGAT AAAAAACATG AATTGAGTGA AATTTTTATG AGACTTCTAG AGTTAGTCCA AATGTAGTTT AAGTCTGTAA CTTGATTATT TTCTCTAAAA ATATGATTAA  CTTAGACAAT TCTAAAACAA ACAAAAAAAA AAGTTTTCTT TCTGTTCAAA TTGAACACTT ATTCTGTTGC TTTTGAATTT GATCATTCAC TAAACAATCT TAAATCAGAT TTCACATATA  CTTTTACTAA ACTATTAATT AGTCACACAT TTTCTCAAAT ATCAATAAAA GGATTTGCAA ATTTAGGAAG TTGTGTTTAG TGCAAATTAT CCTAGTTGCA AATAAAATCC AAAAACAATA  AATTCCTAGT TGCAACTTGT ACGTTGCTTT CTTTCATATG AGGGATGGTA TTTCAATAAT TTTGTTAACG TCCAAAAAGA ACGAATTAAG AGCTCTTTTT ATACCACACA ATTTCCAAAA  ATAAAAAAAT CAGATGCACA ATTTTAAGTG CACAAAAAAC ATTGTTTTTT GTCATGCTTG CCATTGTAAA CGATTTTTAA TATGTCTTCG TGAGCTTAGC TCAATTGGTA TGGACAATGC  ATAAAATATG CAAAGTCCGG GGTTCGAATC ATGGTCACCA CAAAAAAAAA AAGATTTTTA ATAGTTAATC CTCAATTATA CTACCTCTGT TCCTAAATAT AAGACCCTTT TGAAAAAAAA  ATGTCTCTTT TTATAAGATC TATTTGGTTT TTCCAAATAC ATTAATTAGT TCTTTACCAA CATACCCCTA TTTATTTTAT ATCCTTTTCT TCAATCAACA TTAAATACTA TGTTAAAAAC  ATACACTAGT CTTCTCTCTT AAAGGATAAA ATTGTAAAAA TAATAGTAAT TATAAACAAA TTTATTATCA CTTTCAATTT TCTTAATTCC CATTATTTTT TCAAAATGAC ATATAATTAA  GGAGAGAGGT AATATTAAGG TTTTCTCTCA ATTCAAATCA TTTATTCCAT CACATTTGAA TTTGATCGTT GGTTAAAACA ATCTTAAATC AGATTTCCCA TGAAGTATTT GTTAATCAAA  CTATAAATTA GTCAAACATT TCCTCAAATA CCAAGAAAAC TTTAGCAAAT TTAGGAATTT GTGTTTTAGT GCAAATTATC CTAGTTGCAA ATTAAGTCCA AAGACAATAA ATTTCTAGTT  GCAACTTGTA TGCTGCTTTC TTCTTTACGG GGAATGGTAT TTCAATGATT TTATAAGAGG AATGTTATTT AAACAATTAT TTTATAGAAT AATTTGTGGG ACAATTAAAA TATACAAAAA  AATATAGGTT TTGACACAAA AGCTAAAGAG AGAGAGATTT ATCATAAAAA TTGTCACAGA ATGAGAACCA ATTAATTGCT CTTTTTGTCC CACACAATTT CCCAAAAAAA GTTGATCTAA  TGCAAAAAAA AACATCTTTT ATTTTTCATC TTCAAAACAG TGCATCCGAA GAAAATCATG ATTTCTGCTC TTTCGAAATG ATGCATTCAA ACGGATTTTT TTTTTTCTTT TATGGAAGAA  ACTTAAGGGG AACTTATGAA AGTCAAGGCA TATCTTAAAA GCTCGATGCT AACATAGGTG TTCATAGATC ACCCATATCA AAGAGGTTCT CATGCTGTCT CCGAGAGGTA TATCCATAAT 
CTTGCAAACA AGTCATTGCT TATCAACCGA GACAACTTTC ATTAGACACA TCAAAACGGA TTTGTTTTTA TAAGAAAAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGGAATATAATAGCAAAACTCTCAACCAATTATTGCATGACACATAGTACCATAGCTCACTCAATATTTTCATCTACCATTAAATATCCTTCAAATCAAAGAGGAAAGTTACAA
AACCTTATGTCTAGTGTCTCCTCTTTCCACACAACAAACAAACATACTCATAGTTCAAAACAAAACAACAAACGTAGTACCATGTTTCAGATTCCCAACAACCGACCCATTATCACCATG
TTTCTGTTTCTGATCTTCATCATAAACATCATCACAGTAACATCATCATCATCAGATCTTCGACCTGGGTTTTACTCAAAAACATGTCCAAAAGCTGAAACCATTGTCAGAGATGTTATG
AGAAAAGCTCTTATAAGAGAACCAAGAAGTGTTGCCTCTGTTATGAGACTTCAGTTTCATGATTGCTTTGTTAAT
GTATGTTCTCTCTCTCTCTATTCTTTCTTACCATCAAAATTCTAT
CTTTTCAATCAGTTATCTTTTTTAAGTTACAATCTTTTCAATTACTATAAAATTTACGTTTTTCTTTTTGGTGTTTAATCTTATTAGAATATCTACTTCGATTTTTTTTTTGACAAGGAA
TATCTACTTTCATGTTGCTTCAAATTACAAAATTGAATGTTTTTAGTAAGATTGAAAGCATGTAGTTTTGTAATTTGTAGATATGAGAAGTTGGTACAAGACTAAAAACAAAATTCAAGA
TTATAGAACTTATTTTTATTATAATTCTCTGATCTTCAGAGGGAAGGGTTTGGTAATCTATGAAGCACGGACAATCCTCGGATTAGGCGTGTGTCGGGTCCGACACTGACACATATAATT
ACACTAAATTATGTGATTTTCTCAAGTTTTAGATGTGTCGGTGTGTCAGTGTCAGTGTGTGTCTGGTGTCCGTATCTGTATCCATGCTTCATAGCGAGTAATCCAAACTTTGACCGAGCA
TTTTTCCAAAGATTTTTTTAGTTAGAATTCGAATTTGGATATTTCGAAACAATTTGTCTTTAACTAAGAGTTTAAAATTCATTAATCATTTGAGCTCAATTGTTTACTTGGATAATTAGA
GAACTAAAAAATATATTTAATTATTTTTCTATTAAAAAACTTATTTTTCTTTGGTTGAATGAGTTGTTGAATTTGTGAAGGGGTGTGATGGTTCTGTGTTGCTTGATGATACACCAACTA
TGCTTGGAGAAAAATTGGCTCTTTCAAATATAAATTCACTTAGATCATTTGAAGTTGTTGATGAGGTTAAGGAGGCATTAGAGAAAGCTTGCCCTGGAGTTGTTTCTTGTGCTGATATTA
TTATTATGGCTTCTAGAGATGCTGTAGCACTG
GTTTGTATTTATCTCTCTATCTTTCAAAATTAAAAATTAAAAATTTATGATTTATGAATATGACTCTTCTAAAGTGATACTTTAGTGA
ATAACTTCACAGATATCTCAACAGCTAATAAGAATATCAATAGTTAGTATTTTAATTTGTTATGTACATATACACGTTGAGATTACTTATTTTTGAATAAAATTATTATTTAATTTATGC
CGTTTTCTAAGGGTGAAATGTTATGTATATTTGCATTCAAAATTTGTTGATTTTTTTTGGCTGAGTCAGTAGTAAGAACATAGGAAGATGCATGCCCTGTAGTGATATCTGTCTTTGTTC
ATGTCATGAACTTACACACATCAAATATATTTATCTTATGGCTGAATTTTTTCCTTTCCAAATTCTGTTGTAAACTAGATGTGTTATTGAGACTGCATATGCAAATGTACAATTTTTGTT
TACTTTTATTGCAGACAGGAGGACCAGATTGGGAGGTGAGGTTAGGAAGATTGGACAGCTTAACAGCAAGTCAAGAAGACTCAGACAATATCATGCCAAGTCCAAGAGCCAATGCAAGCA
CTCTCATTGATCTCTTCCAAAGATTCAACCTCACTGTCAAAGACCTTGTAGCACTCTCAGGATCTCACTCTATCGGCCAAGGTCGATGTTTTTCGATCATGTTTCGGCTATACAATCAAT
CAGGTAGTGGAAAACCCGACCCTGCACTTGATCCTGCTTTTAGACTAGAGCTTGACAAGCTATGCCCACTAGATGTTGACCAAAATAAGACAGGGAACCTTGACTCAACTCCCGTGATTT
TCGATAACCAATATTTCAAGGACTTGGTTGGTGGAAGAGGATTTCTCAACTCTGATCAAACACTTTTCACTTACCCTCAAACAAAAGGGTTAGTGAGGTTCTATAGTAGAGATCAAAGTG
AGTTTTTCAAAGCATTTGTTAAAGGGATGTTGAAAATGGGTGATTTGCAGTCCGGTCGACCTGGAGAGGTTAGGAGGAATTGCAGAGTTGTGAATGATCGCTTCGCTTATGTTCTGTTTC
AACACAAGATGCAGAAAAATGTTAAATCAATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGGGAATATAATAGCAAAACTCTCAACCAATTATTGCATGACACATAGTACCATAGCTCACTCAATATTTTCATCTACCATTAAATATCCTTCAAATCAAAGAGGAAAGTTACAA
AACCTTATGTCTAGTGTCTCCTCTTTCCACACAACAAACAAACATACTCATAGTTCAAAACAAAACAACAAACGTAGTACCATGTTTCAGATTCCCAACAACCGACCCATTATCACCATG
TTTCTGTTTCTGATCTTCATCATAAACATCATCACAGTAACATCATCATCATCAGATCTTCGACCTGGGTTTTACTCAAAAACATGTCCAAAAGCTGAAACCATTGTCAGAGATGTTATG
AGAAAAGCTCTTATAAGAGAACCAAGAAGTGTTGCCTCTGTTATGAGACTTCAGTTTCATGATTGCTTTGTTAAT
GGGTGTGATGGTTCTGTGTTGCTTGATGATACACCAACTATGCTT
GGAGAAAAATTGGCTCTTTCAAATATAAATTCACTTAGATCATTTGAAGTTGTTGATGAGGTTAAGGAGGCATTAGAGAAAGCTTGCCCTGGAGTTGTTTCTTGTGCTGATATTATTATT
ATGGCTTCTAGAGATGCTGTAGCACTG
ACAGGAGGACCAGATTGGGAGGTGAGGTTAGGAAGATTGGACAGCTTAACAGCAAGTCAAGAAGACTCAGACAATATCATGCCAAGTCCAAGA
GCCAATGCAAGCACTCTCATTGATCTCTTCCAAAGATTCAACCTCACTGTCAAAGACCTTGTAGCACTCTCAGGATCTCACTCTATCGGCCAAGGTCGATGTTTTTCGATCATGTTTCGG
CTATACAATCAATCAGGTAGTGGAAAACCCGACCCTGCACTTGATCCTGCTTTTAGACTAGAGCTTGACAAGCTATGCCCACTAGATGTTGACCAAAATAAGACAGGGAACCTTGACTCA
ACTCCCGTGATTTTCGATAACCAATATTTCAAGGACTTGGTTGGTGGAAGAGGATTTCTCAACTCTGATCAAACACTTTTCACTTACCCTCAAACAAAAGGGTTAGTGAGGTTCTATAGT
AGAGATCAAAGTGAGTTTTTCAAAGCATTTGTTAAAGGGATGTTGAAAATGGGTGATTTGCAGTCCGGTCGACCTGGAGAGGTTAGGAGGAATTGCAGAGTTGTGAATGATCGCTTCGCT
TATGTTCTGTTTCAACACAAGATGCAGAAAAATGTTAAATCAATCTGA

Retrieve as FASTA