Entry information : MtPrx95 (Medtr4g031140.1[4.0] / Medtr4g031140[3.5] / Medtr4g032230[3.0])
Entry ID 2825
Creation 2006-03-03 (Christophe Dunand)
Last sequence changes 2011-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx95 (Medtr4g031140.1[4.0] / Medtr4g031140[3.5] / Medtr4g032230[3.0])
Name (synonym) MtPrx95 (Medtr4g031140.1[4.0] / Medtr4g031140[3.5] / Medtr4g032230[3.0])
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Glandular trichome
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx95
start..stop
S start..stop
MtPrx94 570 0 21..343 93..415
PvPrx17 545 0 20..338 21..339
GmPrx48 539 0 8..331 5..330
GmPrx231 535 0 19..340 15..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10586360..10586578 219 N° 2 10585953..10586144 192 N° 3 10584953..10585573 621  
complement(join(10584953..10585573,10585953..10586144,10586360..10586578))


exon

Literature and cross-references MtPrx95 (Medtr4g031140.1[4.0] / Medtr4g031140[3.5] / Medtr4g032230[3.0])
Literature Town,C.D., Tallon,L.J., Arbogast,T., Althoff,R., Hine,E., Monaghan,E., Smith,S.A., Utterback,T., Feldblyum,T. and Koo,H. Medicago truncatula BAC genomic sequence.
DNA ref. Phytozome 12:   chr4 (10586578..10584953)
EST ref. GenBank:   EX530839
Cluster/Prediction ref. Phytozome Gene 12:   31114351
Protein sequence: MtPrx95 (Medtr4g031140.1[4.0] / Medtr4g031140[3.5] / Medtr4g032230[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343
PWM (Da):   %s   37933.12 Transmb domain:   %s   i7-26o
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFQDKTKITMLMFLIFIINIIIVTSTDLRPGYYSKTCPQAETTVRDVMRNALKKEPRSVASVMRFQFHDCFVNGCDGSVLLDDTPTMLGEKLALSNINSLRSFEVVDEVKEALEKACPGVVSCADIIIMASRDAVALTGGPDWEVRLGRLDSLTASQDNSSNIMPSPRTNATALITLFQKYNLSVKDLVALSGSHSIGKARCFSIMFRLYNQSGSGKPDPAIDHVFRAELDKLCPRDVDQNKTGNLDATPVIFDNQYFKDLVGGRGFLNSDQTLFTFPQTKGFVSLFSEDQSEFFKAFVEGMLKLGDLQSDKPGEVRKNCRVVNARPAHIMSEDKMKNSDLSV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 4, introns 1 and 2) and 1 EST.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCACTTTAT TACTTGGTAA GGATTTGATA CGGTTGCTGA AATTTTTCAA GAAATTTTTG GCACCGCCGC TGGTAGTGTT TATATTTTCA ATGAGGCAAT TTGTTGTACT TATTTATATT  TGTTTTTATT TTAGTTATTT TATTTTTGTC CTTTCATTAC AAAAATATTT ACCGTGATTC AGCCATACTA AAAACTTTGT TTAGTTTGTT TCATACCGTT CAAGTATTAT GCTACTAGAT  CCCGACATAA AAAAAACTGA AAATAGAACT TATGAAAGTT CCTCAAATTG CTAGAGAAAG GACCAATCAC ACTGAAATCA TTCCAATTCA AGAATATTTA TCTAACGAGT CAGAAATGAG  AGACGAGAAT CCACCTATCA CTTTACGAGA CTATGGGAGG CTGGAAAACT TGGATGAAGT ATCTCTTGGG TTCTAACCTG CAAACCCAGT AATGTTCAGA CATGATACAA TTCTTCACAA  CTAGGTTGAA ACCCAACAAC ATCCATGTTG TTGGACGCAT CACCCGGAGG AACAATGAAG ATCAAAACTG TGGAAGAAAT CAnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn  nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnCAGTGAGG TAnGAATTCG AGCTCCGGTA CCCATGGCCT ATAGATCATT TTAACCAATA  AGATTTGGAA ATTGTGTAAG GTTAATTTTT TTTTTTCTTT CTGAAATTTA AGTAGCAAAA ATGAATTAAA TGAAAATTTA ATATTTATGA AACTAAAAAA AAAGTTTGTC GTTTTTCTTT  TTGAGGGAAT TGAGGGAAGA TTGTCAATTA ATTTAAAATC AAGATTAATG AATTTACTAA ACAAATTGAT GAGAATATAA TTGGTAAACT TATTCAATTA TTTGTCGTTT TTCTTAATCC  ATGTAAAATA AATTTCTTAT TAAAAATGAA TATTAATTTA AATAATTAAC AAATTTAAAA TTTAAAATAA TTATTATTAA AAATATATTA TAAAATTAAA ATACTAATTA TTAATTTATT  GACATTAGAA TCTTTCAAAA TAAAACTATT ATCAAAAGGT CAAAAAAATG AAAATTAATT TAAATTATTA AATAATTAAA TATAATTTTC TTTTAAAGGT ATTTATGTCA TTTAATTATG  AAATACATCA TAAACTCATT TGACTTATCT AAAATATATA ATAGAATTCT TTATTTTCTA AAAAATAGAA TTATTAATTT AACTTTATCC TTAGACGAAA TAGACATCAA GCGACCCTTA  ACAAAATACA AGATACATTT GATCTGCTAT AAAATGAACG ACAAAACATG AAAGCTCCAG TTATACATCG TTTGATTTGT AAAATTGGTT CAAGAACATG ACAAACCAAA GGCATGAGAC  AAGACAAAAA CTGAAATTAT TGTCCTTCAT TAAACCACAT CATAATTATT TGTCCCACGT ATAAGTTATC CAAAATAACA TTTTATCCAC AAAAAATCAT ATAAAACAAA AAATTATTCA  TACCATAAAA GTTTATCCTG TGCTATTTTG TATAAGGTTC TGATATTTTG TCTTACGTTG TTGTTCTGTC TTATATTTAA CATATCAAAT GCATCCATAA ACAACTTAGT ATTTCAAATG  AAATAATTTA TTGATCTAAT TGGTATATAC AAGTAACCTT AGATGGAAAA CTAAAAAGAA TCATAGGGAG TAACCAATTA TTTAATTTTA TATTTTGACT AAGAAAATAA GCATTAATTA  TGACACATTT TAGTCAACAA AATTATTATA TTCCATAACC CCTCAAAAGA TTTTTTTTAT TACTATATGC CATAAAGTTA CGAGCCACTC ACTCTCTTTT TCTTCTTCTA CCACTATAAA 
TATCCACCGA ATCAAAGTGG GAAGTAACAA AATCCACAAA CTTTGTAGTC TACCTGTCTC TTCTTTCCAC TCACACAAAC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCAAGACAAAACTAAAATTACCATGCTTATGTTTCTGATCTTCATCATAAACATAATCATAGTAACATCAACAGATCTTCGACCTGGGTATTACTCAAAAACATGTCCACAAGCT
GAAACAACTGTGAGAGATGTTATGAGAAATGCTCTTAAAAAAGAACCAAGAAGTGTTGCCTCTGTTATGAGATTTCAATTTCATGATTGCTTTGTTAAT
GTATGTTCTCTCTTTACCTTT
CTTATACCATCAAAATTCAATATTTTCAATCAGTTGTTTTTTAGATTTATGTATATCTTTTTAATCGCTACAAATATTTTGTCACATAATTGCAATAAATATTTTTAGTTAGACATAAAA
TTTAAAATATGTTGACCCAAAATTATTTATAAAATTATTTTTCTTTGGTTGAATGAGTTGATTAATTTGTGAAGGGGTGTGATGGTTCTGTGTTGCTTGATGATACACCAACTATGCTTG
GAGAAAAATTGGCTCTTTCAAATATAAATTCACTTAGATCATTTGAAGTTGTTGATGAGGTTAAGGAGGCATTAGAGAAAGCTTGTCCTGGAGTTGTTTCTTGTGCTGATATCATTATTA
TGGCTTCTAGAGATGCTGTAGCACTG
GTTTGTATTTCTCTCTATCCTTCAATTCTTTTACTTTTATGATTAATGAACATGATTTTTTTCTTCTTCTTAATGAATTTGACTCTTTTTTTAT
TGTTTTTTTTATTTACTCGATTTGATTTAAAAATAAATATATATGACTCTTCTAGAAAATCAATTTTTTAATCTCAACCGTCTGATCTCGAATTAAAAGACGGGTTCTTTTAAATTTTAT
TTTGTTATTGTGTAATCTGAGCCATCCGATCTCAAATTAATGACTCAGATTGTTTACTGTGCGATCCAGATCCTTATTGAGGCTGCATATTCAAATTTACTCTTTTTTTTTTTTATTTTT
TTTTTATTTTTTTTTTATTTTTTTTTTTTATCACTTTCATTACAGACAGGAGGACCTGATTGGGAAGTGAGGTTAGGAAGATTGGACAGCCTAACAGCAAGTCAAGATAACTCAAGTAAT
ATCATGCCAAGTCCAAGAACTAATGCTACCGCTCTCATTACTCTCTTCCAAAAATACAACCTCAGTGTCAAAGACCTTGTAGCACTCTCAGGATCACACTCTATCGGCAAAGCTCGTTGT
TTCTCAATCATGTTTCGGCTATACAATCAATCCGGTAGCGGAAAGCCTGACCCTGCAATTGATCATGTATTTAGGGCAGAGCTTGACAAGCTATGTCCTCGAGATGTTGATCAAAATAAG
ACAGGAAACCTTGATGCAACTCCTGTGATTTTCGATAACCAATATTTCAAGGACTTGGTTGGTGGAAGAGGATTTCTCAACTCTGATCAAACACTTTTCACTTTTCCTCAAACAAAGGGG
TTTGTGAGTTTGTTTAGCGAAGATCAAAGCGAGTTTTTCAAAGCATTTGTTGAAGGAATGTTGAAATTGGGTGATTTGCAGTCCGATAAGCCCGGTGAAGTCAGGAAGAATTGCAGAGTT
GTCAATGCTCGTCCTGCTCATATCATGTCTGAAGACAAGATGAAGAATAGCGATCTATCGGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCAAGACAAAACTAAAATTACCATGCTTATGTTTCTGATCTTCATCATAAACATAATCATAGTAACATCAACAGATCTTCGACCTGGGTATTACTCAAAAACATGTCCACAAGCT
GAAACAACTGTGAGAGATGTTATGAGAAATGCTCTTAAAAAAGAACCAAGAAGTGTTGCCTCTGTTATGAGATTTCAATTTCATGATTGCTTTGTTAAT
GGGTGTGATGGTTCTGTGTTG
CTTGATGATACACCAACTATGCTTGGAGAAAAATTGGCTCTTTCAAATATAAATTCACTTAGATCATTTGAAGTTGTTGATGAGGTTAAGGAGGCATTAGAGAAAGCTTGTCCTGGAGTT
GTTTCTTGTGCTGATATCATTATTATGGCTTCTAGAGATGCTGTAGCACTG
ACAGGAGGACCTGATTGGGAAGTGAGGTTAGGAAGATTGGACAGCCTAACAGCAAGTCAAGATAACTCA
AGTAATATCATGCCAAGTCCAAGAACTAATGCTACCGCTCTCATTACTCTCTTCCAAAAATACAACCTCAGTGTCAAAGACCTTGTAGCACTCTCAGGATCACACTCTATCGGCAAAGCT
CGTTGTTTCTCAATCATGTTTCGGCTATACAATCAATCCGGTAGCGGAAAGCCTGACCCTGCAATTGATCATGTATTTAGGGCAGAGCTTGACAAGCTATGTCCTCGAGATGTTGATCAA
AATAAGACAGGAAACCTTGATGCAACTCCTGTGATTTTCGATAACCAATATTTCAAGGACTTGGTTGGTGGAAGAGGATTTCTCAACTCTGATCAAACACTTTTCACTTTTCCTCAAACA
AAGGGGTTTGTGAGTTTGTTTAGCGAAGATCAAAGCGAGTTTTTCAAAGCATTTGTTGAAGGAATGTTGAAATTGGGTGATTTGCAGTCCGATAAGCCCGGTGAAGTCAGGAAGAATTGC
AGAGTTGTCAATGCTCGTCCTGCTCATATCATGTCTGAAGACAAGATGAAGAATAGCGATCTATCGGTATAA

Retrieve as FASTA