Entry information : MguAPx01 (mgv1a011241m)
Entry ID 2864
Creation 2006-03-06 (Christophe Dunand)
Last sequence changes 2011-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: MguAPx01 (mgv1a011241m)
Name (synonym) MguAPx01 (mgv1a011241m)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Phrymaceae Mimulus
Organism Mimulus guttatus    [TaxId: 4155 ]
Cellular localisation Peroxisomal
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MguAPx01
start..stop
S start..stop
SaAPx06 516 0 1..287 1..287
OcAPx02 512 0 1..288 1..288
CanAPx03 498 0 1..288 1..287
StAPx05 498 1.26e-180 1..288 1..287
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2864' 'complement(join(1876434..1876631,1877161..1877263,1877357..1877436,1877536..1877618,1877949..1877997,1878173..1878238,1878965..1879014,1879703..1879827,1879961..1880073))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1879961..1880073 111 N° 2 1879703..1879827 123 N° 3 1878965..1879014 48 N° 4 1878173..1878238 64
N° 5 1877949..1877997 47 N° 6 1877536..1877618 81 N° 7 1877357..1877436 78 N° 8 1877161..1877263 101
N° 9 1876434..1876631 196  
complement(join(1876434..1876631,1877161..1877263,1877357..1877436,1877536..1877 618,1877949..1877997,1878173..1878238,1878965..1879014,1879703..1879827,1879961. .1880073))


exon

Literature and cross-references MguAPx01 (mgv1a011241m)
Literature Plant Genome Network
DNA ref. Phytozome 12:   scaffold_18 (1880073..1876434)
Cluster/Prediction ref. PGN unigene:   396073
Protein sequence: MguAPx01 (mgv1a011241m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288 (282)
PWM (Da):   %s   31636.41 (30543.2) Transmb domain:   %s   o259-281i
PI (pH):   %s   7.97 (8.14) Peptide Signal:   %s   cut: 17 range:17-298
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLIVDSEYLKDVDKARRELRALISNKNCAPIMLRLAWHDAGTYDVNTKTGGPNGSIRNEEEYTHGANSGLKIALDFEAVKSKCPRITYADLYLAGVVAVEVTGGPTINFVPGRKDSKISPKEGRLPDAKKGVPHLKDVFYRMGLSDKEIVALSGA
HT
GRAHPERSGFDGPWTKEPLKFDNSYFQELLKGESEGLLKLPTDVALLDVPEFRHYVELYADEDTFFKDYAESHKKLSELGFSPAPTGAKAIVKDCTILAQSAVGVAVAATVVILSYFY
EVRKKMK*

Retrieve as FASTA  
Remarks Complete sequence from 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAACTAATCGTCGACTCAGAATACCTCAAGGATGTCGACAAAGCTCGCCGTGAGCTCCGCGCTCTGATCTCCAACAAAAATTGCGCACCGATTATGCTTCGCTTGGCGTAAATT
TTCATTTTCGTTTTCTCCTCTCTGAATTTTTTTTTCCGATTTTCACTTTGAGATGATAGTTTCACAAATCGAGTTCGAGATTAGTTCTATTCGTTTACCGGTTTTTGTTGATTATATGTT
TACTAGATATGGCATGATGCGGGGACTTATGATGTGAACACGAAGACTGGAGGCCCGAACGGTTCGATTCGGAACGAGGAGGAGTACACTCATGGCGCTAATAGCGGCTTGAAAATCGCG
CTCGATTTTTGCG
GTCAGTTACGTTAGGTTTTTGCGAGGTTATTTTTGCAGATTAATCTGTCTCTAGATTCGAAACGTTAAATAGTTTAGCATGCTTGTATGTGTTGCTTCATATACGTT
AATCAAGCATCTGGTGCTGTTAATTGTTGGATAGTTTGGAAAATTATCATGAGTGTTGGATTATTTTCTGATTGAATATGATTGACTTCGCGGTTGATTCTGGTTATGCCTGTGTATTTT
GATGAGTTTGCATGCTGAACGATGGGAATTTATGTTATCTTGTGCGATTGAGATGTTCGTAATTATACGATCATACTCTCAGGTTGATATATCTTTGCTGCGATACCAGGATTGAACATA
TCTTACTGTTGAACATAGTTTTACTTGATTGCGTTCATAAGTTATTCACGAGTCTGGTGCATTTGTGCAAGTTTCCGGGCTTGGTTAATTGGTTAATTGTTTATGACTTTGTAAATGGAA
ACTTATGTCTCTTATCTATGTCCGTACTTTAGGATGTGAAAATTTCACATCAGTTGGCCTTGTCTTGATTGATATTGAAGCATAGTTATTTGAATAGTTTTTATTTAGCGTGGTGGCAGA
ATTGAGCTTAGCGTGTCTGTTGAATTTAGAGAATATAAGTCCTTCATTTGAAAGTGTACATCTACCGGTTTTCTTATGGTCAGTTTTGTGTCTGATTGCAGAAAAGCGGTGAAGTCTAAA
TGCCCGAGAATTACATATGCAGATTTGTACCAG
GTAATTTGCTTGGCTGGCTGCTTTTGGTTGCAATCGAGAAATAAAACCTTGTATAAGATAATCAGTTTTTCTATGTCAATGACCTAG
TGCAAGCAAGTTTAAGATCTTGACTAATTATTATGCAGTAGCGATTTTACGCAAGGGGTTGGAGTATTGAATTCTCTAGACTTATTTATATTGTATCCATAACATCGCTCGAAAAATATG
TGTTTAAGTTATTTGTGCTCTGCCCTTGTAGATAACATTACTCAATGAAATAAGTGTAAACAATCGTGCACTGCCTGTTGAGATAAAATCACTCAAAGAAAATTTTAATATTTGTAACTG
CTAAACAAGTGCACGGGCATGCAAATTCTAATCCTGCTTCAGGGAATTATACTGGAGTACTAATACTGGAAATTTAGTGAATGTGAAGCATTGATTGGGAAGGAAATGAACAGAACCACT
CTAATTTGTCGTTTTTTGATACTACCTCAACGTCACTTAGGGATGGGATGGATTGGGAAGAATCTAAAATCTAAAGTTACTGTTTCATTGAAATGTGCCGATAATTTTTTTTATTCTGGA
ATTGTTTTCTTGTTATCACGAAGTACACTGCGCATGTATTCTGCCTTGGATTCTCCAATTCATTTTTTGTCTCTATCAAGATATATGGATTTTTATATTTTCATGCTGTACTGGATGGTT
GGATAAGTTAAGAGCAATCTGTTTTGTGCTTGCCTACAGCTCTTGCAGGTGTTGTTGCAGTAGAAGTCACTGGAGGCCCGACAATTAATTTTGTTCCTGGTAGAAAGGTACTCTTAATCT
ATCTTACATAAATAAAACAAAACTTGTCTTGTGCTAGAAGTTAAGCCTCATCATTCATCATGGATTAGGAACTAAAATTAGATTACGTGTATTGGCAAATTAGCTTAATCACATTAAGAA
ATAAGAACAATATTAATGCTATCCATCTCATGTTTCTTTCAGGAGATTCAAAGATTTCTCCAAAGGAAGGGCGGCTTCCAGATGCTAAAAAAGGTCAAACATAATATAATGGAAATCATA
GTTGTCTGAACTTGCTATGATTAGATGCTATGATAACCACTATATGTGCTAATGCACATGCTATTTGCTCTACATTCTTTCACTGACATCATCAGATGTTAAAAAAACACTTTCTGCTTA
TATTGTCTCTCTATAAATATATTACAACTAACTGGAATTTTATATAGTAAAAATCCTTTTGCAATGACATTTCCTGCTCTTGCTCGTATATTGGCTTTAAGTTTTCAGAATCTGGCCACT
TGTGAACTTTAATGAAGAGTGATTGGAAGTTCAACTAACATACTCTTTTGCATTCAATGTTAGGTGTGTGCCACATCTGAAGGATGTGTTTTATCGGATGGGTTTGTCCGATAAAGAAAT
CGTGGCACTATCTGGCGCTCACACCCTG
GTAATTTCCATTTAATCACTTCCATGAATATAACCCACCTAGTGAACTTTTTTCTAAAGAACTTCTTTGACATAATTTGGTTATTAATATTT
GTTTTAGGGGGAAGGGCACACCCTGAGAGATCGGGCTTTGATGGCCCTTGGACTAAAGAGCCACTGAAATTTGATAATTCATACTTTCAGTAAGTCCTTTAGAGTATATCAATGACCTTT
TATCTATAATTATTATGATTATTTGTTCTTTTATGCCATTTCTACACGTTTATCTGAACCAGGGGGAGCTGCTTAAGGGAGAAAGTGAGGGACTGCTAAAACTCCCAACTGATGTTGCTT
TGCTGGATGTTCCTGAGTTTAGGCATTATGTTGAGCTTTATGCAAAG
GTACATTATTGGCTTCTAATCATCCACTTTAACAATGATTATGTTTCTTATTGGCAATTAGGATTTTGCACAA
CAGTCCATTTTAAAAGTTTATTCATGTCTCAATCAAGGACCTGAGAATCACCTGTTTTAAATCTTGGTTAATCTCAAAAGCTGATTCTAAAGAAGTTAAAGTTCACAAAAGTTAATTGCA
AAAATCCTTTTCATCTTCTAATCAGCTTATATCATCATCATGATTCCCAGTCAACTTACTTTTGCACATGCCTCGTTAGAAAAAACAAATTTCTTTTGTCCAATGATATTATTATTAGCT
TTCGGCCCTGACTAGGACATATTTTACTCAATGAAACTTTGGAATGCTATTTGGTATCTGCCTATTTCACCATTAATGTTATGACTTTGTGGGCCATATCCGTTGTTAAACGGCCCAATT
GTTTGCTTTAGCAGGCTAATGTTCATCATTACTACATAATTTCAAAAGTAGTTTGGGCCACTCTTGTAACCATTGTCTCATCATCCGCACATGCAGGAGATGAAGATACCTTCTTCAAAG
ATTACGCCGAGTCCCATAAAAAACTTTCCGAATTAGGATTTTCCCCAGCTCCAACTGGTGCAAAGGCAATTGTCAAAGATTGCACCATACTGGCACAAAGTGCCGTTGGAGTTGCTGTTG
CTGCTACAGTGGTGATCCTGAGTTACTTTTACGAAGTCAGAAAAAAGATGAAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAACTAATCGTCGACTCAGAATACCTCAAGGATGTCGACAAAGCTCGCCGTGAGCTCCGCGCTCTGATCTCCAACAAAAATTGCGCACCGATTATGCTTCGCTTGGCATGGCAT
GATGCGGGGACTTATGATGTGAACACGAAGACTGGAGGCCCGAACGGTTCGATTCGGAACGAGGAGGAGTACACTCATGGCGCTAATAGCGGCTTGAAAATCGCGCTCGATTTTTGCG
AA
GCGGTGAAGTCTAAATGCCCGAGAATTACATATGCAGATTTGTACCAG
CTTGCAGGTGTTGTTGCAGTAGAAGTCACTGGAGGCCCGACAATTAATTTTGTTCCTGGTAGAAAGGATTCA
AAGATTTCTCCAAAGGAAGGGCGGCTTCCAGATGCTAAAAAAG
GTGTGCCACATCTGAAGGATGTGTTTTATCGGATGGGTTTGTCCGATAAAGAAATCGTGGCACTATCTGGCGCTCAC
ACCCTG
GGAAGGGCACACCCTGAGAGATCGGGCTTTGATGGCCCTTGGACTAAAGAGCCACTGAAATTTGATAATTCATACTTTCAGGAGCTGCTTAAGGGAGAAAGTGAGGGACTGCTA
AAACTCCCAACTGATGTTGCTTTGCTGGATGTTCCTGAGTTTAGGCATTATGTTGAGCTTTATGCAAAG
GATGAAGATACCTTCTTCAAAGATTACGCCGAGTCCCATAAAAAACTTTCC
GAATTAGGATTTTCCCCAGCTCCAACTGGTGCAAAGGCAATTGTCAAAGATTGCACCATACTGGCACAAAGTGCCGTTGGAGTTGCTGTTGCTGCTACAGTGGTGATCCTGAGTTACTTT
TACGAAGTCAGAAAAAAGATGAAATAG

Retrieve as FASTA