Entry information : PtAPx01 (POPTR_0006s13440 / Potri.006G132200)
Entry ID 2872
Creation 2006-04-04 (Felipe Teixeira)
Last sequence changes 2010-08-02 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx01 (POPTR_0006s13440 / Potri.006G132200)
Name (synonym) PtAPx01 (POPTR_0006s13440 / Potri.006G132200)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Cytosolic
Tissue type Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx01
start..stop
S start..stop
PtAPx02 488 3e-178 1..249 1..249
PbAPx01 488 3e-178 1..249 1..249
QshAPx01 476 1e-173 1..248 1..248
PtriAPx02 474 8e-173 1..249 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10851418..10851536 119 N° 2 10851109..10851283 175 N° 3 10850932..10850997 66 N° 4 10849565..10849613 49
N° 5 10849394..10849476 83 N° 6 10849225..10849304 80 N° 7 10848920..10849022 103 N° 8 10848716..10848774 59
N° 9 10848585..10848600 16  
complement(join(10848585..10848600,10848716..10848774,10848920..10849022,1084922 5..10849304,10849394..10849476,10849565..10849613,10850932..10850997,10851109..1 0851283,10851418..10851536))


exon

Literature and cross-references PtAPx01 (POPTR_0006s13440 / Potri.006G132200)
Literature Ralph,S., et al., Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   Chr06 (10851536..10848585)
EST ref. GenBank:   DT495423.1 [5' end]   CV232507.1 [3' end] UniGene:   Pth.17238
Cluster/Prediction ref. JGI gene:   675956
Omic ref. ePlant:   Potri.006G132200
Protein sequence: PtAPx01 (POPTR_0006s13440 / Potri.006G132200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   27348.72  
PI (pH):   %s   5.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKSYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVHTKTGGPFGTIRHPDELAHGANNGLDIAIRLLEPIKEQFPILSYADFYLAGVVAVEVTGGPEIPFHPGRPDKSDPPPEGRLPDATKGSDHLRDVFGHMGLSDTDIVALSGGHTGRCHKERSGFEGPWTPNPLVFDNSYFKELLSGEKEGLIQLPSDKTLLEDPVFRPLVENYADEDAFFADYSEAHLKLSELGYADS

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 2 ESTs. Very short last exon (YADS) not found with Scipio. Cultivar="VT-125".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGAGCTACCCTACAGTGAGTGAAGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGCCTCATCGCTGAAAAACATTGCGCTCCTCTCATGCTCAGATTAGCG
TACGGATATCTCTGTTTTTCTATCTGATTTTTTTTTGGAGAGTTTGAGAGGAGTGAGTGGTAGTGATTGAAGTATGTATGGGGTTCTAAATATGTGTGTGTGTGTGTGTGTGTTTTTGTT
TTTGTTGATGTAGATGGCATTCTGCTGGTACGTTTGATGTCCATACAAAGACAGGAGGACCGTTCGGTACGATCAGACACCCAGATGAGCTTGCTCATGGAGCTAACAATGGTCTTGATA
TTGCTATCAGGCTTTTGGAACCCATCAAAGAACAATTCCCCATCTTGTCTTATGCTGACTTCTACCAA
GTAATGTTTGCCGTGCCTTTATTTGATTTATAAATTAATAATTATGTTTTCT
TTTTCTTGATTTATTTATGATTGAGGTTTTTGTATGTGTGTGTTTGATTTTCCGTGCAGTTAGCTGGTGTTGTTGCTGTTGAAGTTACAGGAGGGCCTGAGATTCCTTTTCACCCTGGGA
GACCA
GTTAAGTGATTAGATCGTCGCTTAATAATTTATTCTTCATCTGTTCTTTGTCATTCGTGTTTTTCCGCTTTGTTTTGTGCCTGATATTGATGTTCTTTTTATCTAGAAAAAAAAA
ACTATGTCCAAAGTTCATATATCTTGATCAGTTTAATAGGATCAAGCTCTAGATATGCGCACAAGGATCTTTTGGTGGTCTGATGGTTTTCAATTTGATCTGAAGATCATATATTTGAAC
TCATAGTAATGCAATAAGTTTGGTAGAGTTTGATTACTTTGTAGGTCATTCAGGATGCAGCTAATGAAGTCTGTTCTTTGTATGGTACACCACAAAGGAAATTCTATGGAGGAGGAAATG
CTCTGGATTTAAGAGCTTTGCTCCCACTGCTGCATTATAGGACTAACCTGCAATGCATGCGCTTTTGTTTTTGGATGAATTTCCAAGTTTGAATTCAATGGACAGATATAATTTAGTGGC
TTACTGATATCAGTCCTTGCTATCAAGGTAAATTGATTGGTTCTGAGTTTACCAAACGCCTAAATGTTTGGGAGGGAAAGTGAGTAGTGTGAAATGATTTTTATTTGTGAAACATCGTGC
AGTGCTAATTATGGACTTGAAAATAGATGATGTGCATGTTATAGTCCTTATATGGTAAAGATTGCTAGTTGTATTTGTTTGCTCCCACTAAAGATTAGGTTGAGTTTAGCTCGTACTAAA
TAGTGCAAGCTCTGCCCAGTTGAGTTTCCTTCAACTCCTTTTATGAATTAGTTAGCTTGAACATGGTTCATTATGCTAGGTGGTGACAGGCCAAATGTGTTAGAGAGAAGGGGTTGGACA
ATAATATTATGGATTCCTTGTACTGTGATCGATTAAAGATGTTTGCTCATAATTGGAGTGAACTGTGAGGTCATATGGCACAATTAGATACGATCTATTTAAAAGCCATTGACTGTAGTT
CCTGATACCTGGAATTAGTTCAGCACTTTTCCTTCATTGCTTTTGTGGCTTTGATGGGATGTGGACGGCTGTTCAGATCGAAGAAGAGCTTATTATTGGTTGGGATATGATTGCAAAATG
CAGTATATTTTCAAGTTTGTTTTTGTTTTTTTTTTTTCTGTTCTTAGAGCAGTATGATATGAATATTCGTAGAGTTGTAGAAATAGGAATGGTATGCCAGAAAGAAACCATATTAATGCA
AATTCTGACAACTGTCTCTAACGACCATTGTGGCATTTTGCTCTTGTTGATGTTATCAGCTGCCTTTTCAGAATTCATGCTTCAGTTTTTAGGGTAGTACTAATCAACCTTGCATTTGTT
CAGGACAAGTCTGATCCACCTCCAGAAGGTCGCTTGCCTGATGCAACCAAAGGTTTGTCCTAGATGAAAACTGAAGGAAATCATTATAATTTTGTAATTATGTTTCAAATGAATTTCATG
ATCTTTTTCTGTCACTTCAGGTTCAGACCATTTAAGGGATGTATTTGGCCACATGGGTCTCAGTGACACAGATATTGTTGCCCTATCCGGTGGTCACACTCTGGTCTGTTCACAAACATG
GAATTACGTAAAGAACTTTCTTCTTATTCTTTTTTGTTTGTGTACTATTGGTGTTTGCACATATATTTACAGGGGAGGTGCCATAAGGAGCGTTCTGGATTCGAGGGACCCTGGACCCCC
AACCCACTTGTTTTCGACAACTCCTATTTCAA
GTAAGACACATTCAGCTCCAGAGATGTTCTTTCCAGAGATGTTCTTTCTTGACATAATTCTGTCTGGAATTCAGATCTTAATGCTTGA
TTTTGCCAGTATGTGATTGTCTCGCTGTTATCCCCACAATCTAATACCAAATCTGTCGTTCAGAAAACAGGATGCAATCAAGTAACTGATGCAAATTTTGATTCTGTTGAGCAGGGAACT
CCTCAGTGGAGAGAAAGAAGGTCTTATCCAGCTTCCATCAGACAAAACTCTTCTGGAGGATCCAGTCTTCCGTCCCCTTGTTGAAAACTATGCTGAA
GTGAGTGTCTGGTCATTTCTTCT
AGATATTAGCTTATAAATTTTCAAAAGTTGCATTAGATGGAAATTTCATCCTATCAACTTGACAATAATCTGGTCCTAAAGTGTAATTATCAAGCTTTGACACGGTGGTGGCATTGTTTC
AGGATGAGGATGCATTCTTTGCAGATTATTCAGAAGCTCATTTGAAGCTGTCGGAGCTTGGGTAAGCAAAAAAGCAACTTTCAATTCTGTCTCTCTTTAACCAGTTACCTTGTCCATGTA
GTTTTGTTGTCTCTGATCTTCTCCTAAATTTGTCCACTGCTGCAATTGCATTTCAGATATGCTGATTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGAGCTACCCTACAGTGAGTGAAGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGCCTCATCGCTGAAAAACATTGCGCTCCTCTCATGCTCAGATTAGCA
TGGCATTCTGCTGGTACGTTTGATGTCCATACAAAGACAGGAGGACCGTTCGGTACGATCAGACACCCAGATGAGCTTGCTCATGGAGCTAACAATGGTCTTGATATTGCTATCAGGCTT
TTGGAACCCATCAAAGAACAATTCCCCATCTTGTCTTATGCTGACTTCTACCAA
TTAGCTGGTGTTGTTGCTGTTGAAGTTACAGGAGGGCCTGAGATTCCTTTTCACCCTGGGAGACCA
GACAAGTCTGATCCACCTCCAGAAGGTCGCTTGCCTGATGCAACCAAAGGTTCAGACCATTTAAGGGATGTATTTGGCCACATGGGTCTCAGTGACACAGATATTGTTGCCCTATCCGGT
GGTCACACTCTG
GGGAGGTGCCATAAGGAGCGTTCTGGATTCGAGGGACCCTGGACCCCCAACCCACTTGTTTTCGACAACTCCTATTTCAAGGAACTCCTCAGTGGAGAGAAAGAAGGT
CTTATCCAGCTTCCATCAGACAAAACTCTTCTGGAGGATCCAGTCTTCCGTCCCCTTGTTGAAAACTATGCTGAA
GATGAGGATGCATTCTTTGCAGATTATTCAGAAGCTCATTTGAAG
CTGTCGGAGCTTGG
ATATGCTGATTCTTAG

Retrieve as FASTA