Entry information : PtAPx02 (POPTR_0016s08580 / Potri.016G084800)
Entry ID 2873
Creation 2006-04-04 (Felipe Teixeira)
Last sequence changes 2006-04-04 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtAPx02 (POPTR_0016s08580 / Potri.016G084800)
Name (synonym) PtAPx02 (POPTR_0016s08580 / Potri.016G084800)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation Cytosolic
Tissue types Buds
Leaves
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtAPx02
start..stop
S start..stop
PbAPx01 514 0 1..250 1..250
PtAPx01 488 3e-178 1..249 1..249
PtriAPx02 481 2e-175 1..249 1..249
CclAPx05 481 3e-175 1..249 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6654838..6654956 119 N° 2 6655075..6655249 175 N° 3 6655354..6655419 66 N° 4 6656600..6656648 49
N° 5 6656737..6656819 83 N° 6 6656953..6657032 80 N° 7 6657243..6657345 103 N° 8 6657501..6657559 59
N° 9 6657679..6657697 19  
join(6654838..6654956,6655075..6655249,6655354..6655419,6656600..6656648,6656737 ..6656819,6656953..6657032,6657243..6657345,6657501..6657559,6657679..6657697)


exon

Literature and cross-references PtAPx02 (POPTR_0016s08580 / Potri.016G084800)
Literature Ralph,S.G., Chun,H.J.E., Cooper,D., Kirkpatrick,R., Palmquist,D., Wynhoven,B., Kolosova,N., Oddy,C., Jancsik,S., Douglas,C.J., Liu,J., Butterfield,Y.S.N., Stott,J., Yang,G., Holt,R.A., Siddiqui,A., Jones,S.J.M., Marra,M.A., Ritland,K. and Bohlmann,J. The poplar transcriptome: Analysis of ca. 4,700 sequence-verified full-length cDNAs
DNA ref. Phytozome 12:   Chr16 (6654838..6657697)
Cluster/Prediction ref. JGI gene:   576642 UniGene:   Pth.2200
Omic ref. ePlant:   Potri.016G084800
Protein sequence: PtAPx02 (POPTR_0016s08580 / Potri.016G084800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27396.76  
PI (pH):   %s   5.57
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKCYPTVSEEYQKAVEKCKRKLRGLIAEKHCAPLMLRLAWHSAGTFDVNTKTGGPFGTIRHPDELAHGANNGLDIAVRLLEPLKEQFPNLSYADFYLAGVVAVEITGGPEVPFHPGRPDKSDPPPEGRLPDATKGSDHLRDVFGHMGLSDKDIVALSGGHTGRCHKERSGFEGPWTPNPLVFDNSYFKELLSGEKEGLIQLPTDKTLLEDPVFRPLVEKYADEDAFFADYAEAHMKLSELGFAEAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns), 1 mRNA and 36 ESTs. Very short last exons (FAEAY).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGTGCTACCCTACAGTGAGCGAAGAGTATCAGAAGGCAGTGGAGAAATGCAAGAGGAAGCTCAGAGGACTCATCGCTGAAAAACACTGCGCTCCCCTCATGCTCCGATTAGCG
TAAGACTACCCCCCCCCCTCCCCTCTCTGATTGTTTTATTTCCCTTTCTTTTTGATAGTGGTAGCTGTTTTAAGTATTTATGGGATTTTATATTCTCTGTTGTTGTTGATGATGTAGATG
GCACTCTGCTGGTACTTTTGATGTGAATACCAAGACAGGAGGGCCATTTGGGACGATCAGACACCCAGATGAGCTTGCTCATGGAGCTAACAATGGTCTTGATATTGCTGTCAGGCTTTT
GGAACCCCTCAAAGAGCAGTTCCCCAACTTGTCTTATGCTGACTTCTACCAA
GTAATGTTTTCCCTGCCTTAATTTGATTTATATATTAATAATAGTGTTTTTATTTTATTTTATTCATG
ATTGAGACTTTTTTGTGTGTTTGATTGTCCTCGCAGTTAGCTGGTGTTGTTGCTGTTGAAATTACTGGAGGGCCTGAGGTTCCTTTTCACCCTGGGAGACCAGTTAAGTGATCAGATCTC
CTCTTGATAGTTCATTCTTTATCAGTTCTTTTTCATACGTGGTGGTGTTTCTTTCATCGTTATTCTGTGCCTGATATCGAAGTTCCTTTTTTTCTAGGGAAAATATAAATCATGTCCAAA
CTCCAAAGTACATATATTTTTTAATTAGTTTATAGGATCAATCTCTAGATGTGTGTTGTAGGATCTTTTGGTGGCCTGATGGTTTCTTTTTTATCTGAAGATCACAACTTTGAACTCATA
GTGAATGCAATAAGTTTGGTTGAGTTTGATTACTTTGTAGGTCTTTCAGGTAATAGATAGTATAGGCAAAAGAAATTCCATGGAGGAGGAAGTGTTCTGGATTTAAGAGTTTTCACCTAC
TGCTGCATTATAAGGCTAACCTGCAACGCATGCATTTTTTTTTTGGTTGAATTTTGAAATTCGGGTTCAATGGACAGATATAATTTAGTTGTTTAGTGATATCAGTCCTACCTTACCGTC
AAGGTAAATTGACTACTCTTGTACTTGTTTGCTTTGACTAAAGATTAGGTTGAGTTTAGCTTGAACTAAATTGTAGAAGCTCTGTCCATCTGCGACCAAATGAAAGTGATGTGGATCTTA
GGTTAACCTGTGACCAAATTGTCAAAGCTAAGTTCCGCCAACTTCTTTAATGTATTAGTTAGCTTGAAAACATGGTTCATTATGATAGATGGTGACTGGCCAAATGTGTTAGAGACAATG
GACTTGAACAATGATGATATGGCTGACTTGTACTGCTATCGATTAAGCTGTTTGTTCAGAGTTGGAGTGAACAGTGCGGTCATATGGCACAATTAGATACCATCTATTTGAATGCCATTG
ACTGCTGTTGTTCCTGATACCTAGAAATATTTTGCACTTTTCCTTGATTGCTTTTGTAGCTCTGGTGGGATGCCGACGGGGCCATTCAAATGAAGAAGAGCTTATTATTTGTTGGGATAT
CATTGCAAATTGCAGTATATATTTCAAAGCTGTTTGCAATACTTTGAGTAGTCTGATATGAATTTTTGTAGATTTGTAGAGATAGGAAGCAGTATGTCAGAAAGAAATATAGCGATGCAG
ATTCTGATGTCATTAGCTGCCTTTTCAGAATTCATGCTTCAGTTCTTAGATGATTGTACTAATCAACCTTGCATTTATTCAGGACAAGTCTGATCCACCTCCAGAAGGTCGCTTGCCTGA
TGCAACCAAAG
GTTTGTTCAAGTTGAAAACTGAAGGAAATCACTATAATTTTGTAATTGTGTTTCAAGTGGATTTCCTAATCTTTTTCTATCGCTTCAGGTTCAGACCATTTAAGGGATG
TCTTTGGCCATATGGGTCTTAGTGACAAAGATATTGTTGCCCTATCCGGTGGTCACACTCTG
GTCTGTTCAAAGAACATGGAATTTCTCTGCTGGTTTCTTTTATGATTGTTGCTCATGT
TGTGCGATTTAAGTGAATAATTGTCTTATTCTATTTATTGATGTTTATCATTGGTTTTTAAATATATATTTACAGGGAAGGTGCCACAAGGAGCGTTCTGGATTTGAGGGACCCTGGACC
CCCAACCCTCTTGTTTTCGACAACTCCTATTTCAA
GTAAGATACATTCAGCTCCAGATATGTTTTTTATTGATATAATTTTGTCAAGAATTCAAGTTATATTGCATGATTTTTCTATTCT
GTAATCATCTCACCAACTGGTGTTTTACATATGCTTTTATCCCCGCAAACTAATACTGAATCATTTGTTAAAGAAAAAGAAGATGCGGTCAAATAACCAATGCGAATTTTGATTCTGTTA
AACAGGGAACTCCTCAGTGGAGAGAAAGAAGGTCTTATCCAGCTCCCTACAGATAAAACCCTTCTGGAGGATCCAGTCTTCCGCCCCCTTGTTGAAAAATATGCTGCAGTGAGTAGACAC
TCATTTCTTTTTTATATTAGCCTATAGATTTTCTAAAGTTGACCTTGGATGGAAATTCCCCCCATCAACTTGACAATAATCTGGTCCTAAATTACACTAAAGTGTAATTATCTAACTTTG
ACGTCATGGTGGCTTATCTTTAGGATGAGGATGCCTTCTTTGCAGATTATGCTGAAGCTCATATGAAGCTCTCAGAGCTTGGGTAAGTAAAAAGCAACTTTCAATTTCTGTACTACTCTC
TTTAACCATTTGCCTTGTCCATATGGTTTTGGTGTCTCTGATCTTCTTCTAAATTCGATCACTGCTGCAATTGCATTTCAGGTTTGCCGAGGCATATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCAAGTGCTACCCTACAGTGAGCGAAGAGTATCAGAAGGCAGTGGAGAAATGCAAGAGGAAGCTCAGAGGACTCATCGCTGAAAAACACTGCGCTCCCCTCATGCTCCGATTAGCA
TGGCACTCTGCTGGTACTTTTGATGTGAATACCAAGACAGGAGGGCCATTTGGGACGATCAGACACCCAGATGAGCTTGCTCATGGAGCTAACAATGGTCTTGATATTGCTGTCAGGCTT
TTGGAACCCCTCAAAGAGCAGTTCCCCAACTTGTCTTATGCTGACTTCTACCAA
TTAGCTGGTGTTGTTGCTGTTGAAATTACTGGAGGGCCTGAGGTTCCTTTTCACCCTGGGAGACCA
GACAAGTCTGATCCACCTCCAGAAGGTCGCTTGCCTGATGCAACCAAAGGTTCAGACCATTTAAGGGATGTCTTTGGCCATATGGGTCTTAGTGACAAAGATATTGTTGCCCTATCCGGT
GGTCACACTCTG
GGAAGGTGCCACAAGGAGCGTTCTGGATTTGAGGGACCCTGGACCCCCAACCCTCTTGTTTTCGACAACTCCTATTTCAAGGAACTCCTCAGTGGAGAGAAAGAAGGT
CTTATCCAGCTCCCTACAGATAAAACCCTTCTGGAGGATCCAGTCTTCCGCCCCCTTGTTGAAAAATATGCTGCA
GATGAGGATGCCTTCTTTGCAGATTATGCTGAAGCTCATATGAAG
CTCTCAGAGCTTGG
GTTTGCCGAGGCATATTGA

Retrieve as FASTA