1. Browse the Database
  2. View Redoxidase
Entry information : PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Entry ID 2884
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Name (synonym) PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Buds
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx02
start..stop		 S start..stop
HbGPx02 315 1.98e-112 1..167 1..167
EgrGPx02 313 5.39e-111 1..167 36..202
EglGPx01 313 6.5e-111 1..167 36..202
EguGPx01 310 6.95e-110 1..167 36..202
Gene structure Fichier Exons►


exon

Literature and cross-references PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Literature JGI.
DNA ref. Phytozome 12:   scaffold_7 (1284612..1282488)
Cluster/Prediction ref. UniGene:   Pth.1748
Omic ref. ePlant:   Potri.007G126600
Protein sequence: PtGPx02 (POPTR_0007s02160 / Potri.007G126600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167 (298)
PWM (Da):   %s   18655.46 (32496.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.83 (5.71) Peptide Signal:   %s   cut: 22 range:22-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEESPKSIYDFTVKDIHGNDTSLSEYSGKVLLIVNVASKCGLTHSNYKELNVLYEKYKNGFEILAFPCNQFAGQEPGSNEEIQDTVCTIFKAEFPIFDIDVNGKNTAPVYKFLKSEKGGYFGDAIKWNFTKFLVNKEGKVVERY
APTTSPLKIEKDIQNLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns) and 3 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST