1. Browse the Database
  2. View Redoxidase
Entry information : PtGPx08 (POPTR_0001s09280 / Potri.001G105100)
Entry ID 2885
Creation 2006-03-20 (Felipe Teixeira)
Last sequence changes 2006-03-20 (Felipe Teixeira)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtGPx08 (POPTR_0001s09280 / Potri.001G105100)
Name (synonym) PtGPx08 (POPTR_0001s09280 / Potri.001G105100)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtGPx08
start..stop		 S start..stop
NtGPx08-1A 310 2.41e-110 1..169 1..169
LeGPx08 309 6.48e-110 1..168 1..168
StGPx08 305 4.1e-108 1..168 1..168
CclGPx04 299 5.01e-106 1..170 1..170
Gene structure Fichier Exons►


exon

Literature and cross-references PtGPx08 (POPTR_0001s09280 / Potri.001G105100)
Literature JGI.
DNA ref. Phytozome 12:   scaffold_1 (7094688..7096255)
Cluster/Prediction ref. JGI gene:   548472
Omic ref. ePlant:   Potri.001G105100
Protein sequence: PtGPx08 (POPTR_0001s09280 / Potri.001G105100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19299.63 Transmb domain:   %s   i7-29o
PI (pH):   %s   4.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATQTSKNPESVHDFTIKDAKENDVDLSIFKGKVLLIVNVASKCGMTNSNYAEMNQLYEKYKDGLEILAFPCNQFGEEEPGTNDQITDFVCTRFKSEFPIFDIDVNGENASPLYKFLKLG
KWGIFGDDIQWNFAKFLVNKDGQVVDRYYPTTSPLSLERDIKQLLEIS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns). No EST found.
DNA ►
Send to BLAST
CDS►
Send to BLAST