Entry information : OsGPx02(riPHGPX / GPX-4 / LOC_Os03g24380)
Entry ID 2890
Creation 2006-03-20 (Marcia Pinheiro Margis)
Last sequence changes 2006-03-20 (Marcia Pinheiro Margis)
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-01-26 (Catherine )
Peroxidase information: OsGPx02(riPHGPX / GPX-4 / LOC_Os03g24380)
Name OsGPx02(riPHGPX / GPX-4 / LOC_Os03g24380)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Embryos
Flowers
Leaves
Pannicles
Pistils
Seedling roots
Seedling shoots
Seeds
Shoots
Spikelets
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsGPx02
start..stop
S start..stop
HvGPx02 323 1.23e-115 1..166 1..166
ZmGPx02 322 7.75e-115 1..169 1..170
SbGPx02 318 1.13e-113 1..169 1..170
AlyGPx04 274 4.81e-96 1..169 1..169
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2890' 'join(13712339..13712392,13712506..13712582,13712715..13712776,13713231..13713349,13714928..13715095,13715183..13715212)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13712339..13712392 52 N° 2 13712506..13712582 75 N° 3 13712715..13712776 60 N° 4 13713231..13713349 117
N° 5 13714928..13715095 166 N° 6 13715183..13715212 28  
join(13712339..13712392,13712506..13712582,13712715..13712776,13713231..13713349 ,13714928..13715095,13715183..13715212)


exon

Literature and cross-references OsGPx02(riPHGPX / GPX-4 / LOC_Os03g24380)
Literature REFERENCE 1: Li,W.J., Feng,H., Fan,J.H., Zhang,R.Q., Zhao,N.M. and Liu,J.Y. Molecular cloning and expression of a phospholipid hydroperoxide glutathione peroxidase homolog in Oryza sativa. Biochim. Biophys. Acta 1493:225-230(2000).
REFERENCE 2: Li W.J., Feng H., Fan J.H.; Molecular cloning and expression of a phospholipid hydroperoxide glutathione peroxidase homolog in Oryza sativa. Biochim. Biophys. Acta 1493:225-230(2000).
Protein ref. GenPept:   ABF96054 UniProtKB:   Q10L56  Q9FEV2 [Other strain]
DNA ref. GenBank:   NC_008396.1 (13712339..13715209)
Cluster/Prediction ref. UniGene:   Os.8539
Protein sequence: OsGPx02(riPHGPX / GPX-4 / LOC_Os03g24380)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169 (296)
PWM (Da):   %s   19106.83 (31716.8)  
PI (pH):   %s   9.37 (8.79) Peptide Signal:   %s   cut: 23 range:23-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAESVPETSIHEFTVKDCNGKEVSLEMYKGKVLIVVNVASKCGFTETNYTQLTELYQKHRDDFEILAFPCNQFLRQEPGSDQQIKDFACTRFKAEYPVFQVRVNGPDAAPLYKFLKASKPGLFGSRIKWNFTKFLIDKNGKVI
NRYSTATSPLSFE
KDILKALED*

Retrieve as FASTA  
Remarks Sequence from genomic (chromo 3, 5 introns), 2 cDNAs and 79 ESTs (UNIGENE). Cultivar="Zhongdan II and Nipponbare. Two SwissProt/TREMBL accession: Q9FEV2 and Q10L56 (different strains)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCGGAATCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGAGGTCCGGCGATCTCCCCCCCATCTCCTCTTCCGCCGCCGGATTACGCGACGGATTTTTGCTGATT
TTTTTTCTCGTTTTCTTTTTTCTTTTTTAATTGTTTTTTTTTTGAGCAGGATTGCAACGGCAAGGAGGTGAGCCTGGAGATGTACAAGGGGAAGGTGCTAATCGTCGTCAACGTCGCCTC
CAAATG
TGGTATATACTTCGCCATCACGATCCTGTCCTCACCATGGTCGTGGGTAGAATTTTCTTTTTTCTTTTTTTTTGGGTGTGTGAAAATGGTGTTCTTGACTGCGGGTATGCTTTG
ATTTGATCTGTACCGGGCAGTGGGTTCACGGAGACCAACTACACGCAGCTGACGGAGCTCTATCAGAAACACAGGGACAAAGAGGTTAGTCTGCGCCGCGCATCCATAGCATATATCCAG
TGACTGAAGAGCGATTGCAGTTCGTAATTTGGAGTAATCGATACTGTATCGATCATGGATACGTGTTGGCGACTAGGCTCTATGTTGTTTTCAAGTGTATTAACATGTTAGTCTAATTAG
TGTTTCCCGCAAAAAAAATCTGATTGATACTAACGAAGTATATAAATCTTACCCAAAAACCGAAAGGATATTATGTGTTTAAGTAAAATTTATAATGGCGAATTGTGATCTATGCGTTTA
AGTTGTAAGTTTCATTGCACTCCAGTTGGATATTATGTGAATGCAATACACAAGACCTATTGGCTTTTACAGTGTTAGTTGCAGTATTTGATTATATTTGGATCGAATATTTCTTTAAAA
GTTCCACTTATCTTTGGTTTAGGACAAAACTAACTTCACCTGCTTCCAACATGAGCAGATTTTGAGATTCTAGCATTTCCCTGCAATCAGTTCTTGCGACAAGAGCCAGGATCTGACCAG
CAAATAAAGGATTTTGCTTGCACAAGATTTAAAGCTGAATATCCCGTTTTTCAGAAG
AGGTAAGAACTATCCGATGAACCTGCTTGCTTGCTGGAAGCTTCCAATTATTTATTAATTAGT
GAATCCTCAGTTTGAGTCCCTCATTATTGGTACTTAGAGCTTAAAACACTATCTGTATCCTTCTTTTTTAACAGGAAACAGTAGAGAGAACCCTACTGAAACTAATTTTAAATAAATAAA
TACATATGAATCTACAAAGATCAAAAGGAGCAGGAAGTTCAAACCATAGGCCTTAAATCTCTACCAGCAATCGAAATGTTATAGAAAACACACTTGAAATTCCAATGCAAACTATCCTAC
CCGATTTTTCAGAGCATCAACCAACTTCTGAAAAAGTAATAGTTTGAGCCAAATCAAGCCCAACAACAAAGTTATTTCCAGTCCGTGCCTCATTATTGGAACCTTGTCATGTATGCCCCT
GTTCCTTTGTGTCCAAATGTTCTAATTAGGACCTGCATGTGCCTTTGCTGTGCCCCTGTTCCTTTGTGTCCAAATGTTCTAATTAGGACCTGCATGTGCCTTTGCTGGGCAATAGCATTG
ATACCAATTAATTAAATGTGTGCATGGAGAATAAGAGAGTAGATCAACTGACTTTGTTTCCCTCCATTATACCACACGGAAATATGAGTCATTTATTCATGAGAGTGATAACACTTATTT
TGTGAGGGCCACTGGCCCAGGAAGGAGAAGATGAGGGAATACCTAGAAATTCTAGGATGACTTATATTTAGGAAATTAACTGAGAAGGTTAAGATAGCTTATAAATCAGAGGGAGTATCT
TAGTAGGTTTTGCTGAACTGACATTTAAAAAATAGTTGCATCGAGTCCTTCACTCCTGCATCCAAATTACATATAGCACAATGATTACAAGTTATAGTTCTTGATTCTGCAGCATACCAC
TTGCAGTTATTTTTCCTTTTCAAAAGTGTTTGTAAGAAGAGTTTAGGCATAAGCGTATGCATTAGAATGCATTAGAAAGAACTTTTGTACACACTAGAATGCACTAGATCCCCAAAGGGG
AGACCAGATATCCTGGCAATCATGCGTCTCTACAAAAGAGATAATCACTGATAACTCTTGCAACTGTTTACTGGCAATTTATAATAGAAATGAAAATCTAGCAATAGAAATTCTGTGCAT
CTATGTTTTCCCTTTTCCATATGAATGTAGCTGAGGATATTATTCTTTTAGGAAAGAATTGAGCCAGAGATCCTCAGGTCTAGATAAGGCATCAGTTGTTTTAGGACTCGTTACCATTGA
GAAGAGCCTTTTCCACTATTTTCATGAAGGTGAAAAAGTTCTACATTATCTTTGCCACAAGATATTTTACCTTTTCTTTATTAAAAATAACTTTTGAAAATATGTTAAAAGAATCTAGAG
ACTAGCCACATTACGTCTTCTAATGTTGATGATAACCTAATGCAAAGCAATACTATCTAATTATCTTTTTGTAAGAATTTATTTGAATCCCATATTTCTTGCAATCATTACATAGCCATA
ACAATTACGACATGTGGATTTATTTAACTTTATTTTGTTGGAAGCCGCTAGTTATTTTTCAAATTTTGTATCTGCAGGTGCGTGTAAATGGTCCTGATGCTGCACCACTTTACAAATTTT
TGAAAGCTAGCAAGCCTGGCTTGTTTGGATCTAGAATCAAGTGGAACTTTACCAAATTTCTTATTGATAAGAATGGCAAAGTCATTAACAGATACTCGACTGCGACCAGTCCCTTGTCTT
TTGAG
AGGTCTCTCTCTCTCTCTCTCTCTAGCCTCTCGCTTACTCGCTCTATATGCACATACACAATTTTGATATATCTGTTTAAAATGTACAGAAAGACATCCTGAAGGCGCTCGAGGA
TTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCGGCGGAATCCGTGCCGGAGACCTCCATACACGAATTCACCGTCAAGGATTGCAACGGCAAGGAGGTGAGCCTGGAGATGTACAAGGGGAAGGTGCTAATCGTCGTCAACGTC
GCCTCCAAATG
TGGGTTCACGGAGACCAACTACACGCAGCTGACGGAGCTCTATCAGAAACACAGGGACAAAGATTTTGAGATTCTAGCATTTCCCTGCAATCAGTTCTTGCGACAAGAG
CCAGGATCTGACCAGCAAATAAAGGATTTTGCTTGCACAAGATTTAAAGCTGAATATCCCGTTTTTCAGAAG
GTGCGTGTAAATGGTCCTGATGCTGCACCACTTTACAAATTTTTGAAA
GCTAGCAAGCCTGGCTTGTTTGGATCTAGAATCAAGTGGAACTTTACCAAATTTCTTATTGATAAGAATGGCAAAGTCATTAACAGATACTCGACTGCGACCAGTCCCTTGTCTTTTGAG
AAAGACATCCTGAAGGCGCTCGAGGATTAG

Retrieve as FASTA