Entry information : OsGPx01(GPX1 / LOC_Os04g46960)
Entry ID 2892
Creation 2006-03-20 (Marcia Pinheiro Margis)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-01-26 (Catherine )
Peroxidase information: OsGPx01(GPX1 / LOC_Os04g46960)
Name OsGPx01(GPX1 / LOC_Os04g46960)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer Constitutively induced
Repressor N/D
Best BLASTp hits
Perox score E-value OsGPx01
start..stop
S start..stop
SpGPx01 332 4.21e-119 1..168 1..168
SbGPx01 332 4.21e-119 1..168 1..168
SiGPx01 328 1.1e-117 1..168 1..168
ZmGPx01 326 1.21e-116 1..168 1..168
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2892' 'join(27812097..27812144,27812386..27812462,27812976..27813037,27813256..27813374,27813511..27813678,27813766..27813798)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27812097..27812144 46 N° 2 27812386..27812462 75 N° 3 27812976..27813037 60 N° 4 27813256..27813374 117
N° 5 27813511..27813678 166 N° 6 27813766..27813798 31  
join(27812097..27812144,27812386..27812462,27812976..27813037,27813256..27813374 ,27813511..27813678,27813766..27813798)


exon

Literature and cross-references OsGPx01(GPX1 / LOC_Os04g46960)
Literature Kang,S.-G. and Suh,H.-S. Characterization of the glutathione peroxidase gene of rice
Protein ref. UniProtKB:   Q0JB49  Q7XU04 [Incorrect splicing]  Q8L8G3 [Other strain]
DNA ref. GenBank:   NC_008397.1 (27812097..27813795)
Cluster/Prediction ref. UniGene:   Os.11255
Protein sequence: OsGPx01(GPX1 / LOC_Os04g46960)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168 (308)
PWM (Da):   %s   18384.36 (34745.8)  
PI (pH):   %s   8.43 (8.21) Peptide Signal:   %s   cut: 23 range:23-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAPSATSVHDFTVKDASGKDVNLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYKVGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDVDVNGNNAAPLYKYLKSNKGGLFGDSIKWNFSKFLVDKEGRVVDR
YAPTTSPLSIE
KDIKKLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 4), 3 cDNA and 241 ESTs. Three SwissProt/TREMBL accessions: Q0JB49 (different strains) and Q7XU04 (extra sequence not confirmed by ESTs).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCGCGCCGTCCGCCACCTCCGTCCACGACTTCACCGTCAAGAGGTCAGTTCCTCCTCTCGGTCGGCGGCGCTCCCTTCTCGAAGGGATCTGTCCTGCAGTGATTGGGATGGGC
TTTCCAAAACCCGTACCCGCTCGAGCAGTCGAGCCGTGCGTACTTTGGGGGGTGGGTGGGGGGGGGGTGCCTGTAATCCGGGGTGGTGCTTGACGTGAATTTGTTGAGCAGTAGTAATTG
GGTGTTTCACCGAATTTCTTAGCTTGTTTTGCTTGGTGCGAGGGCGTGCAGGATGCAAGCGGAAAAGACGTGAACCTGAGCACCTACAAGGGGAAGGTTCTCCTCATCGTTAACGTCGCA
TCCCAATG
TGGTACTTAATTCACTTCATTACGCCCCCCATTTTATGATGGAATTTTACTACTACACCGTCTACACATCAACAGGTTGATGTAGGATTGTTTTAGCGGAATGGCTAGCTAG
AAAACTTCCGCAAGTTTTTTTTTCCCCCAAAACTTTCAGATTTGTTGTCTTTTGCCAAAGAGAATAATAAACTGCTGCAAAACAGAATATCACTAGCAGATTCAGAGCATCCCCAGCCCT
GTTGAGCAGTTGAACTGAACCGGTCCCATATGAATCATGCAAATATCATGATACAAGCACAGCTCATTAACTCATTAACTCGTATTGTGAACTGCGATACTGTCTTTGTTTGGTCTACTG
CAAAGATGGTCCAAATCAATAGGTCCACTGCTGCTTATTTTATGGAACCGTTTTCTGCATAATTGTCCTTATCTGACGTAGGCAGCTCTATATATATTTTTTTATCTATATGGAACCATT
TCACCTTACACCGCTAAGCATTTTCTTCGACCAATTATTTCAGTGGCTTAACTAACTCCAACTACACTGAGCTGAGCCAGCTGTATGAGAAGTACAAGGTCCAAGAGGTGTGTCTTTGAC
CCGTTGCCTTTGTATATCTTTGTATATTGTAATTGCCTTTGCATATTGTACTCCTTCACCATGGAAGTTGGAATAATTATCTAGTTCATGGTCACATGGATCATTAAGCTTTAGTTATTA
TATGTGCTAGTAGTTCTTCACTTTAAACAATTCCGGTTGTTGTGGTTCAAACCGCTAAGGAATATTACCAATGTGTGATTTGTAGGCTTTGAGATATTGGCTTTCCCGTGCAATCAGTTT
GGAGGGCAGGAACCCGGCTCCAATGAGGAGATTGTCCAGTTTGCTTGCACTCGCTTCAAGGCTGAGTATCCCATTTTTGACAAG
AGGTAAGTTAACGCAATACTTTTAACTCAATCAGAG
TAATTATCAGTGTGAAGCAAAATGATATAAGTCACATGTTTTATCTATCGAAGAGGTGTTTCTGTGGAGTAGCATTGAGTCTCTTTTTTTTTTATCTGTCAGGTTGATGTCAACGGTAAC
AATGCTGCACCCCTGTACAAGTATCTGAAGTCTAACAAAGGTGGGCTTTTCGGTGATAGCATCAAGTGGAACTTCTCCAAATTCTTGGTTGACAAGGAGGGTCGCGTGGTGGATCGCTAT
GCGCCCACCACCTCCCCTCTTAGTATTGAG
AGGTAATGTCCTGCACTACCACTTGCAATCTCTTTCTACAGGCTGAATTGTTAGGCTCTCATTATAACATTTCCATACTATCTCTGCAGA
AGGATATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCGCGCCGTCCGCCACCTCCGTCCACGACTTCACCGTCAAGGATGCAAGCGGAAAAGACGTGAACCTGAGCACCTACAAGGGGAAGGTTCTCCTCATCGTTAACGTCGCATCC
CAATG
TGGCTTAACTAACTCCAACTACACTGAGCTGAGCCAGCTGTATGAGAAGTACAAGGTCCAAGGCTTTGAGATATTGGCTTTCCCGTGCAATCAGTTTGGAGGGCAGGAACCCGGC
TCCAATGAGGAGATTGTCCAGTTTGCTTGCACTCGCTTCAAGGCTGAGTATCCCATTTTTGACAAG
GTTGATGTCAACGGTAACAATGCTGCACCCCTGTACAAGTATCTGAAGTCTAAC
AAAGGTGGGCTTTTCGGTGATAGCATCAAGTGGAACTTCTCCAAATTCTTGGTTGACAAGGAGGGTCGCGTGGTGGATCGCTATGCGCCCACCACCTCCCCTCTTAGTATTGAG
AAGGAT
ATCAAGAAGCTGCTTGGGAGCTCTTAA

Retrieve as FASTA