Entry information : ThPrx72
Entry ID 2906
Creation 2006-03-22 (Christophe Dunand)
Last sequence changes 2015-11-12 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-12 (Achraf Jemmat)
Peroxidase information: ThPrx72
Name ThPrx72
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Thellungiella
Organism Thellungiella halophila (Eutrema halophilum)    [TaxId: 98038 ]
Cellular localisation N/D
Tissue type Leaves
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value ThPrx72
start..stop
S start..stop
TsPrx72 697 0 1..336 1..336
CrubPrx118 665 0 1..336 1..336
CagraPrx81 665 0 1..336 1..336
BstrPrx50 664 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2227..2460 234 N° 2 2559..2750 192 N° 3 2847..3012 166 N° 4 3471..3889 419
join(2227..2460,2559..2750,2847..3012,3471..3889)


exon

Literature and cross-references ThPrx72
Literature Wong,C.E., Li,Y., Whitty,B.R., Diaz-Camino,C., Akhter,S.R., Brandle ,J.E., Golding,G.B., Weretilnyk,E.A., Moffatt,B.A. and Griffith,M. Expressed sequence tags from the Yukon ecotype of Thellungiella reveal that gene expression in response to cold, drought and salinity shows little overlap. Plant Mol. Biol. 58 (4), 561-574 (2005)
DNA ref. GenBank:   DQ226510.1 (2227..3889)
Protein sequence: ThPrx72
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (313)
PWM (Da):   %s   37215.94 (34801.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.95 (9.03) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSLNILIVALSLIAFSPLCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFAHDPRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRDSARGFELIEEIKQALEQACPETVSCADILALAARDSTVITGGPSWEVPLGRRDARGASLSGSNNDIPAPNNTFQTILTKFKRQGLNLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLNQYYAYVLRKQCPKSGGDQNLFSLDFVTPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQEAFFEQFAKSMVKMGNISPLTGMRGEIRRICRRVNHAY

Retrieve as FASTA  
Remarks Complete sequence from DNA
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTCATTGAATATTCTCATCGTAGCTCTCTCCCTCATCGCCTTCTCTCCTCTTTGTTTGTGTTCCAAAGCCTACGGAAGTGGCGGCTACCTCTTCCCTCAGTTCTACGATCAC
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGCACATGACCCTCGCATGCCTGCCTCCTTGCTCAGACTTCATTTCCACGATTGTTTTGTCAAG
GTTTTA
AGCTTAGCTACATCATTGTTTACTTTAACAATATATACATGCAGGAAAAGTTGTAATTATATATAATTTTATTGTTGTGCTTGGTATTGTAGGGATGTGATGCTTCCATACTATTGGACA
GCAGTGGAACCATAATCAGCGAGAAACGATCAAACCCTAACCGTGACTCAGCCCGTGGTTTCGAGCTCATCGAAGAAATCAAACAAGCCTTAGAACAAGCATGTCCTGAAACAGTTTCTT
GCGCTGATATCTTGGCTCTAGCCGCTAGAGACTCAACTGTCATT
GTAAGTCATCACGATTCACTAAAAACACAAATTTACTTGATCGTTAATTATCATTACGAATTTATTAATTCGACAA
ATGGACATATATACATATAGACGGGTGGACCGAGCTGGGAAGTACCTCTAGGAAGAAGAGATGCAAGAGGAGCAAGCTTGAGTGGTTCCAACAATGACATTCCTGCTCCCAACAACACTT
TTCAAACCATCCTCACTAAGTTCAAGCGTCAAGGCCTCAATCTCGTCGATCTTGTCTCCCTCTCTG
GTATATACCCTTGCTCTATCTATCTTAATTACGCAAGACACATTGAAAGAGCTT
ACCTATAGTAATCAACCCATGTTCAAAAACTCATCTTGCTAAAAAAAAATATGTTCAAAAACTCGTAAGAAAAACCCCATATTTTATTTTTATTATTTCTGCCTTTTTATATTATAAAAA
GTATTGTTACATTAACTTTTAAAAAACAACATCTACGAATATGTTAAGGGGGCGTAGAACCAGATTGATAAAAACCATAGTTTGGTGATTTCAGTTTGCTAGTACTATAGTACTAATTCT
TCCGATGAGACATGGATTAATATACGATCAGTCTACTACTTAGCAAATTCATTTTGAATTTTGAGTTAGAAATCACCAATAAAACTTATAACACATTAATTTGTGATTTTTAAAAGAGGT
TACAATAGTTGTATGTAAAAATATACAATGTATATGATTTGTAGGAAGTCACACGATTGGAAACTCGAGGTGCACAAGTTTCCGGCAGAGGTTATACAACCAGTCTGGCAACGGCAAGCC
AGATCTAACACTTAACCAATACTACGCCTACGTGTTGCGTAAGCAATGTCCTAAATCAGGCGGGGACCAAAACCTCTTCTCCCTCGACTTTGTGACGCCGTTCAAGTTCGACAACCACTA
CTTCAAGAACCTGATCATGTACAAAGGGCTACTGAGCTCCGATGAGATTCTGTTCACGAAGAACAGAGAGTCTAAGGAGCTCGTGAAGCTCTACGCTGAGAATCAAGAGGCGTTCTTCGA
GCAGTTCGCGAAATCGATGGTGAAGATGGGGAATATCTCTCCGTTGACTGGCATGAGGGGAGAGATCCGGCGAATCTGTCGTAGGGTTAACCATGCTTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTCATTGAATATTCTCATCGTAGCTCTCTCCCTCATCGCCTTCTCTCCTCTTTGTTTGTGTTCCAAAGCCTACGGAAGTGGCGGCTACCTCTTCCCTCAGTTCTACGATCAC
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGCACATGACCCTCGCATGCCTGCCTCCTTGCTCAGACTTCATTTCCACGATTGTTTTGTCAAG
GGATGT
GATGCTTCCATACTATTGGACAGCAGTGGAACCATAATCAGCGAGAAACGATCAAACCCTAACCGTGACTCAGCCCGTGGTTTCGAGCTCATCGAAGAAATCAAACAAGCCTTAGAACAA
GCATGTCCTGAAACAGTTTCTTGCGCTGATATCTTGGCTCTAGCCGCTAGAGACTCAACTGTCATT
ACGGGTGGACCGAGCTGGGAAGTACCTCTAGGAAGAAGAGATGCAAGAGGAGCA
AGCTTGAGTGGTTCCAACAATGACATTCCTGCTCCCAACAACACTTTTCAAACCATCCTCACTAAGTTCAAGCGTCAAGGCCTCAATCTCGTCGATCTTGTCTCCCTCTCTG
GAAGTCAC
ACGATTGGAAACTCGAGGTGCACAAGTTTCCGGCAGAGGTTATACAACCAGTCTGGCAACGGCAAGCCAGATCTAACACTTAACCAATACTACGCCTACGTGTTGCGTAAGCAATGTCCT
AAATCAGGCGGGGACCAAAACCTCTTCTCCCTCGACTTTGTGACGCCGTTCAAGTTCGACAACCACTACTTCAAGAACCTGATCATGTACAAAGGGCTACTGAGCTCCGATGAGATTCTG
TTCACGAAGAACAGAGAGTCTAAGGAGCTCGTGAAGCTCTACGCTGAGAATCAAGAGGCGTTCTTCGAGCAGTTCGCGAAATCGATGGTGAAGATGGGGAATATCTCTCCGTTGACTGGC
ATGAGGGGAGAGATCCGGCGAATCTGTCGTAGGGTTAACCATGCTTATTAA

Retrieve as FASTA