Entry information : TsPrx[P]64 (Thhalv10028329m)
Entry ID 2913
Creation 2006-03-22 (Christophe Dunand)
Last sequence changes 2011-11-25 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2012-07-27 (Christophe Dunand)
Peroxidase information: TsPrx[P]64 (Thhalv10028329m)
Name (synonym) TsPrx[P]64 (Thhalv10028329m)
Class Class III peroxidase     [Orthogroup: Prx016]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Eutrema
Organism Thellungiella salsuginea (Eutrema salsugineum)    [TaxId: 72664 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TsPrx[P]64
start..stop
S start..stop
TsPrx64-1 385 1e-137 1..184 134..317
BoPrx64-1Ca_other 353 4e-125 1..184 113..296
BrPrx64_other 351 5e-124 1..184 134..317
BstrPrx12 338 9e-119 1..184 134..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1854980..1855136 157 N° 2 1854324..1854721 398  
complement(join(1854324..1854721,1854980..1855136))


exon

Literature and cross-references TsPrx[P]64 (Thhalv10028329m)
DNA ref. Phytozome 12:   scaffold_14 (1855136..1854324)
Protein sequence: TsPrx[P]64 (Thhalv10028329m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   184
PWM (Da):   %s   20332.3  
PI (pH):   %s   10.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GPTWEVPKGRKDGRISKAIETRQLPAPTFNISQLQQSFGQRGLSMHDLVVLSGGHTLGFAHCSSFQNRIHNFNLQKQVDPTLNPSFAASLNVICPAHNKVKNAGATMDATTTYFDNVYYKMLMQGQSLFSFDQALLTTPSSKKLVAKYASSMEEYERAFVKSIIKMSSISGNGKEVRHNCRRVR

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from phytozome. Long 5' end is missing which has not been found yet. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGCCAACGTGGGAAGTTCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACTAGACAACTACCAGCTCCTACGTTCAACATATCTCAATTGCAACAAAGCTTTGGCCAA
AGAGGCCTCTCTATGCACGATCTTGTTGTTCTCTCGG
GTATTCTACATTCTCTTGTTTACTTAAGATATACCAAAATTCAAAAAATAAGTGTAATGTTCGCTTAGTATATTGAAAAATTA
AGATTTCCTAAAAAAAATTATTGAGCAATGCTAAAAGATAAGTTTAGACACAGCATGTTTAGACACAGTTTAGACAGAGGGTGGTATACAGCATGTCTAACGGTTTTTTGAACATTGTAA
TTAACAAATACAAGATCTTAGTTATTAATTTCGGAATGTTTCGTTGAAATGACAGGAGGACACACACTAGGATTTGCCCACTGCTCATCGTTCCAGAATAGGATCCACAACTTCAACTTA
CAAAAACAGGTCGACCCAACACTAAACCCATCATTCGCGGCCAGCTTGAACGTAATTTGCCCTGCCCATAACAAGGTGAAAAACGCTGGTGCAACCATGGATGCAACCACAACGTACTTC
GACAATGTTTACTACAAGATGCTTATGCAAGGCCAGTCACTCTTCTCATTTGACCAAGCGCTTCTCACTACTCCATCAAGTAAAAAACTCGTGGCCAAGTACGCGAGTTCCATGGAAGAG
TACGAGAGGGCTTTTGTGAAGTCCATAATCAAGATGAGTAGTATCAGTGGGAATGGTAAAGAGGTCAGGCATAACTGCAGGAGGGTTCGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGGCCAACGTGGGAAGTTCCAAAAGGGAGAAAAGATGGAAGAATATCAAAGGCAATAGAAACTAGACAACTACCAGCTCCTACGTTCAACATATCTCAATTGCAACAAAGCTTTGGCCAA
AGAGGCCTCTCTATGCACGATCTTGTTGTTCTCTCGG
GAGGACACACACTAGGATTTGCCCACTGCTCATCGTTCCAGAATAGGATCCACAACTTCAACTTACAAAAACAGGTCGACCCA
ACACTAAACCCATCATTCGCGGCCAGCTTGAACGTAATTTGCCCTGCCCATAACAAGGTGAAAAACGCTGGTGCAACCATGGATGCAACCACAACGTACTTCGACAATGTTTACTACAAG
ATGCTTATGCAAGGCCAGTCACTCTTCTCATTTGACCAAGCGCTTCTCACTACTCCATCAAGTAAAAAACTCGTGGCCAAGTACGCGAGTTCCATGGAAGAGTACGAGAGGGCTTTTGTG
AAGTCCATAATCAAGATGAGTAGTATCAGTGGGAATGGTAAAGAGGTCAGGCATAACTGCAGGAGGGTTCGTTAG

Retrieve as FASTA