Entry information : CsaPrx02
Entry ID 2915
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2011-12-13 (Christophe Dunand)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: CsaPrx02
Name CsaPrx02
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type Fruits
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx02
start..stop
S start..stop
CmPrx02 533 0 1..269 19..287
CsaPrx03 501 0 1..269 13..281
CpPrx01 408 4e-145 6..267 14..273
CmPrx01 399 2e-142 1..260 13..270
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 530733..530897 165 N° 2 530467..530655 189 N° 3 530079..530244 166 N° 4 529711..529997 287
complement(join(529711..529997,530079..530244,530467..530655,530733..530897))


exon

Literature and cross-references CsaPrx02
Literature Vergara,G., McGrath,J.M. and Grumet,R.
Cucumber fruit cDNA library. Unpublished (2005)
DNA ref. Phytozome 12:   scaffold01124 (530897..529711)
EST ref. GenBank:   DN910758 [Fragment]
Protein sequence: CsaPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269
PWM (Da):   %s   28995.48  
PI (pH):   %s   5.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LLIGGSFAQLSETFYDQTCPRLANVVRASVKKAIESDIRAGAKLIRLHFHDCFVNGCDGSVLLEDAPGIVSELNSPGNQGIQGLEIVDAIKADVERECPGIVSCADILAQASKDSVDVQGGPSWRVLYGRRDSRIANKTGADSNLASPFETLDQLKAKFRNVGLNTMDLVSLSGAHTFGRSRCRFFSHRFANFNNTGRPDQSLNPDYRSFLEGVCSAGADTRANFDPVTPDVFDKNYYTNLQVGKGLLQSDQELFSTPGADTIAIVNS

Retrieve as FASTA  
Remarks Partial sequence from 1 EST. PS and 3' end are missing. No prediction from from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCTCATCGGCGGCTCTTTCGCTCAACTCTCCGAAACCTTTTACGATCAAACCTGCCCTCGTTTGGCCAACGTTGTGCGCGCCTCCGTCAAGAAAGCCATCGAAAGCGACATCCGTGCG
GGTGCTAAACTTATTCGTCTCCATTTCCACGATTGCTTCGTCAAT
GTACAAAACTCTACACTTTTTCATTAATCTCTCTGTTCTGTTTTGTTTTTAATTTCATGGGGTTGTTGATTTTGT
AGGGATGCGATGGCTCTGTTTTGCTAGAGGATGCTCCCGGCATAGTCAGTGAGCTTAACTCACCTGGAAATCAAGGAATCCAAGGGCTTGAAATTGTCGACGCCATTAAAGCCGACGTCG
AAAGAGAATGCCCTGGCATCGTCTCCTGTGCTGACATCCTAGCTCAGGCTTCTAAAGACTCTGTCGATGTG
GTAAATATTTTTGATCCAATACATTCGTATCGTTTAGCTCATCGCCATG
CTTTAAATCTGTTACTGCTGCTTTGAAGCAGCATGACCAAGTCAAAATCTTGCTATTCCAAACTCGTATTTGACATATTTATATTATATACGTAAAAATAAAAAATGTTCGTAAGTGTAG
AAATCTTTGTGTTGAATTTTTTATTGCTTACTAACGTTTGATCTCATTATCAGCAAGGAGGGCCTAGCTGGAGAGTGTTATACGGAAGACGAGACAGCAGAATAGCAAACAAAACAGGGG
CCGACAGTAACTTGGCTAGTCCCTTCGAAACTCTAGACCAACTTAAAGCTAAATTTAGGAATGTTGGGCTCAATACCATGGATCTCGTCTCTTTATCTG
GTAAAATTAATTAACAAACAA
ATGAATTTAGCAGTAAATGAATTGATGGAAGTGTGGTTAGATTGATGAAACAAATTTCAGGGGCGCATACATTTGGACGATCGAGATGCAGATTCTTCAGCCACCGATTTGCGAATTTCA
ACAATACAGGAAGGCCAGACCAATCATTGAACCCAGACTACAGGAGCTTTCTTGAAGGGGTTTGTTCAGCAGGAGCAGACACAAGAGCGAATTTCGATCCAGTAACACCGGATGTGTTTG
ACAAAAATTACTACACAAATCTTCAAGTGGGGAAGGGGCTTTTGCAGAGCGATCAAGAGCTGTTCTCAACACCTGGAGCTGACACCATCGCCATTGTTAACAGCTTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCTCATCGGCGGCTCTTTCGCTCAACTCTCCGAAACCTTTTACGATCAAACCTGCCCTCGTTTGGCCAACGTTGTGCGCGCCTCCGTCAAGAAAGCCATCGAAAGCGACATCCGTGCG
GGTGCTAAACTTATTCGTCTCCATTTCCACGATTGCTTCGTCAAT
GGATGCGATGGCTCTGTTTTGCTAGAGGATGCTCCCGGCATAGTCAGTGAGCTTAACTCACCTGGAAATCAAGGA
ATCCAAGGGCTTGAAATTGTCGACGCCATTAAAGCCGACGTCGAAAGAGAATGCCCTGGCATCGTCTCCTGTGCTGACATCCTAGCTCAGGCTTCTAAAGACTCTGTCGATGTG
CAAGGA
GGGCCTAGCTGGAGAGTGTTATACGGAAGACGAGACAGCAGAATAGCAAACAAAACAGGGGCCGACAGTAACTTGGCTAGTCCCTTCGAAACTCTAGACCAACTTAAAGCTAAATTTAGG
AATGTTGGGCTCAATACCATGGATCTCGTCTCTTTATCTG
GGGCGCATACATTTGGACGATCGAGATGCAGATTCTTCAGCCACCGATTTGCGAATTTCAACAATACAGGAAGGCCAGAC
CAATCATTGAACCCAGACTACAGGAGCTTTCTTGAAGGGGTTTGTTCAGCAGGAGCAGACACAAGAGCGAATTTCGATCCAGTAACACCGGATGTGTTTGACAAAAATTACTACACAAAT
CTTCAAGTGGGGAAGGGGCTTTTGCAGAGCGATCAAGAGCTGTTCTCAACACCTGGAGCTGACACCATCGCCATTGTTAACAGCTTT

Retrieve as FASTA