Entry information : CsaPrx09 ( Cucsa.247030.1)
Entry ID 2919
Creation 2006-03-23 (Christophe Dunand)
Last sequence changes 2016-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-04 (Achraf Jemmat)
Peroxidase information: CsaPrx09 ( Cucsa.247030.1)
Name (synonym) CsaPrx09 ( Cucsa.247030.1)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis sativus    [TaxId: 3659 ]
Cellular localisation N/D
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsaPrx09
start..stop
S start..stop
MtPrx85 442 2.53e-157 1..331 1..336
NnPrx06 436 1.76e-154 1..331 2..343
GmPrx164 435 2.44e-154 9..332 6..333
LjPrx40 434 2.85e-154 17..331 13..333
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '2919' 'complement(join(69320..69723,69789..69954,70246..70437,70526..70759))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 70526..70759 232 N° 2 70246..70437 190 N° 3 69789..69954 164 N° 4 69320..69723 402
complement(join(69320..69723,69789..69954,70246..70437,70526..70759))


exon

Literature and cross-references CsaPrx09 ( Cucsa.247030.1)
Literature Plant Genome Network.
DNA ref. Phytozome 12:   scaffold02188 (70759..69320)
EST ref. GenBank:   CV005121.1 [3' end]
Protein sequence: CsaPrx09 ( Cucsa.247030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   35339.54 (32787.2)  
PI (pH):   %s   4.6 (4.45) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKYLFFHLSLTIFNLSAIALANMQASYGGGDENLPPFGTPPICPEAEAIVFSWVQTVIGEDPRMAASLLRLHFHDCFGCDASVLLDDNENFVGEKTAAPNVNSLRGFEVIDAIKSELES
VCPQTVSCADILALAARDSVGLSGGPFWKVEFGRGDSISASKSAAQNNIPGPNSTVATLVTKFQNLGLSLRDMVALSGGHTLGKARCTSFSSRLQTNGGSPNEGANQEFIESLKQLCSAP
GSSSTLAQLDIVTPATFDNQYYINLLSGEGLLQSDHVLVTGDYQTREIVETYAVDPVAFFEDFKQSMVKMGSLKPPAGTQTVIRTNCRTVS*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST (CV005121). Incorrect prediction from Phytozome (5' end is missing). FHDCF instead of FHDCFVN due to a point mutation GTTAATGA instaed of GTTAATGC found in the other member of the orthogroup.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTATCTTTTTTTCCACCTTTCTCTAACTATATTTAACCTTTCTGCAATTGCGTTGGCAAACATGCAAGCTTCGTATGGAGGAGGAGACGAAAACCTGCCACCATTCGGCACA
CCTCCTATATGCCCGGAGGCAGAAGCCATCGTCTTCTCTTGGGTCCAAACAGTCATCGGCGAGGACCCCCGGATGGCGGCATCTCTGCTTCGACTCCACTTCCATGACTGCTTT
GTTAAT
GAAAGTCGTACTGTTCTACCTTTTCATTGCCTTGAAAGATTTCCATGAATAATGTGAATGAATTTTTTTTGTTTTGATACAGGGGGATGTGATGCTTCTGTTTTGCTGGATGATAACGAG
AATTTTGTAGGTGAAAAGACCGCAGCTCCAAATGTGAACTCACTTAGAGGATTTGAAGTGATTGATGCAATAAAATCTGAGTTGGAATCTGTTTGCCCACAGACAGTTTCCTGTGCTGAC
ATTCTAGCTCTTGCAGCCAGAGACTCTGTTGGACTA
GTGAGTTCATTATTGACTAAAAAGTTCTAATATTGTAGTCAAAGTATTTACAAGAGGATGTTGTATTCACACATCAAGTTTATT
TTCTCATTAAATTGTAAATTTGATACTTACAAAGTTAGAATTTAATCTCTCTATCTTAACAAAATTAATTCTCATAAATAACCTCTATGATTTGGTGAAGTTCTTATAAATAGTTCCATC
CATTTATCTAAATTCGAACTTTCTCTAACTTTTAGAACTAAATTTGAAATTTGACCTTTTCTTCTTTTTTTTCCAAACAATTTGTAGTCTCAGGAGGACCCTTTTGGAAAGTTGAATTTG
GAAGAGGGGATAGCATAAGTGCCAGCAAATCAGCAGCACAAAACAACATTCCTGGCCCAAACTCCACTGTAGCTACCTTAGTTACTAAGTTCCAGAACCTTGGCCTTTCTCTAAGAGATA
TGGTTGCTCTCTCAG
GTAAATTTTTTTTCTTTTTCCCTTAATCTTTTCATTTTGGTTGATCGTTTCGAGAATTTGTGAAGGGGGGGACACACACTGGGAAAAGCCAGATGTACTTCATTC
AGTTCTAGGCTACAAACGAACGGAGGCAGCCCCAATGAAGGAGCAAACCAAGAGTTTATAGAGTCATTAAAACAGCTCTGCTCGGCACCTGGTAGTAGTTCAACACTGGCACAGCTCGAC
ATTGTAACCCCAGCTACATTTGACAACCAGTACTATATTAATCTTCTCTCTGGAGAAGGGTTACTCCAGTCTGATCATGTTCTTGTGACTGGGGATTACCAAACAAGAGAGATAGTCGAA
ACCTATGCCGTCGACCCAGTTGCCTTCTTTGAAGATTTCAAACAGTCAATGGTGAAGATGGGAAGCCTAAAACCACCTGCTGGAACACAGACCGTGATCCGAACTAATTGTCGAACTGTA
AGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTATCTTTTTTTCCACCTTTCTCTAACTATATTTAACCTTTCTGCAATTGCGTTGGCAAACATGCAAGCTTCGTATGGAGGAGGAGACGAAAACCTGCCACCATTCGGCACA
CCTCCTATATGCCCGGAGGCAGAAGCCATCGTCTTCTCTTGGGTCCAAACAGTCATCGGCGAGGACCCCCGGATGGCGGCATCTCTGCTTCGACTCCACTTCCATGACTGCTTT
GGATGT
GATGCTTCTGTTTTGCTGGATGATAACGAGAATTTTGTAGGTGAAAAGACCGCAGCTCCAAATGTGAACTCACTTAGAGGATTTGAAGTGATTGATGCAATAAAATCTGAGTTGGAATCT
GTTTGCCCACAGACAGTTTCCTGTGCTGACATTCTAGCTCTTGCAGCCAGAGACTCTGTTGGACTA
TCAGGAGGACCCTTTTGGAAAGTTGAATTTGGAAGAGGGGATAGCATAAGTGCC
AGCAAATCAGCAGCACAAAACAACATTCCTGGCCCAAACTCCACTGTAGCTACCTTAGTTACTAAGTTCCAGAACCTTGGCCTTTCTCTAAGAGATATGGTTGCTCTCTCAG
GGGGACAC
ACACTGGGAAAAGCCAGATGTACTTCATTCAGTTCTAGGCTACAAACGAACGGAGGCAGCCCCAATGAAGGAGCAAACCAAGAGTTTATAGAGTCATTAAAACAGCTCTGCTCGGCACCT
GGTAGTAGTTCAACACTGGCACAGCTCGACATTGTAACCCCAGCTACATTTGACAACCAGTACTATATTAATCTTCTCTCTGGAGAAGGGTTACTCCAGTCTGATCATGTTCTTGTGACT
GGGGATTACCAAACAAGAGAGATAGTCGAAACCTATGCCGTCGACCCAGTTGCCTTCTTTGAAGATTTCAAACAGTCAATGGTGAAGATGGGAAGCCTAAAACCACCTGCTGGAACACAG
ACCGTGATCCGAACTAATTGTCGAACTGTAAGCTAG

Retrieve as FASTA