Entry information : ZmGPx01-2
Entry ID 2967
Creation 2007-08-16 (Christophe Dunand)
Last sequence changes 2007-08-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmGPx01-2
Name ZmGPx01-2
Class Plant glutathione peroxidase     [Orthogroup: Gpx2001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmGPx01-2
start..stop
S start..stop
SpGPx01 333 1.55e-119 1..168 1..168
SbGPx01 333 1.55e-119 1..168 1..168
SiGPx01 330 4.14e-118 1..168 1..168
ZmGPx01 327 3.75e-117 1..168 1..168
Gene structure Fichier Exons


exon

Literature and cross-references ZmGPx01-2
Literature REFERENCE 1 Lai J., Ma J., Swigonova Z., Ramakrishna W., Linton E., Llaca V., Tanyolac B., Park Y.J., Jeong O.Y., Bennetzen J.L., Messing J. Gene loss and movement in the maize genome. Genome Res. 14:1924-1931(2004).
REFERENCE 2 Swigonova Z., Bennetzen J.L., Messing J. Structure and evolution of the r/b chromosomal regions in rice, maize, and sorghum. Genetics 169:891-906(2005).
REFERENCE 3 Swigonova Z., Lai J., Ma J., Ramakrishna W., Llaca V., Bennetzen J.L., Messing J. Close split of sorghum and maize genome progenitors. Genome Res. 14:1916-1923(2004).
Protein ref. GenPept:   AAS82602 UniProtKB:   B6SU31  Q7FS88 [Incorrect splicing]
DNA ref. GenBank:   AF466202 (213222..214776)
mRNA ref. GenBank:   EU956246
Cluster/Prediction ref. UniGene:   Zm.94084
Protein sequence: ZmGPx01-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18359.28  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSATSVHDFTVKDSSGKDVDLSVYRGKVLLIVNVASQCGLTNSNYTQQAQLYEKYKNGFEILAFPCNQFGGQEPGTNEEIAQFACTRFKADYPIFDVDVNGNNAAPIYKFLKSSKG
GLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIE
KDIKKLLGSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 10, 5 introns). Incorrect splicing prediction (extra sequence LFLIHCSC). Very similar to ZmGPx01.
DNA
Send to BLAST
CDS
Send to BLAST