Entry information : HaGPx04 (HanXRQChr01g0002361)
Entry ID 3071
Creation 2006-05-19 (Marcia Pinheiro Margis)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx04 (HanXRQChr01g0002361)
Name (synonym) HaGPx04 (HanXRQChr01g0002361)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx04
start..stop
S start..stop
NtGPx05-1B 279 5.14e-98 1..167 1..167
NtGPx05-1A 275 1.81e-96 1..167 1..167
StGPx05 270 2.78e-94 1..167 1..167
EgrGPx09 268 1.33e-93 1..167 1..167
Gene structure Fichier Exons


exon

Literature and cross-references HaGPx04 (HanXRQChr01g0002361)
Literature Kozik,A., Michelmore,R.W., Knapp,S., Matvienko,M., Rieseberg,L., Lin,H., van Damme,M., Lavelle,D., Chevalier,P., Ziegle,J., Ellison ,P., Kolkman,J., Slabaugh,M.S., Livingston,K., Zhou,Y., Lai,Z., Church,S., Jackson,L. and Bradford,K. Lettuce and Sunflower ESTs from the Compositae Genome Project.
DNA ref. HanXRQ genome:   HanXRQChr01 (9286568..9282915)
Cluster/Prediction ref. HanXRQ:   HanXRQChr01g0002361 UniGene:   Han.6693
Protein sequence: HaGPx04 (HanXRQChr01g0002361)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170 (308)
PWM (Da):   %s   18814.67 (32653.3)  
PI (pH):   %s   9.34 (7.67) Peptide Signal:   %s   cut: 37 range:37-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAPSVPENSIHEFTVKDAKGKDVDLSIYKGKVVLIVNVASKCGFTNSNYPKMAELHVKYRDGFEILAFPCNQFLYQEPEASEKVEEFACSRFNAEYPIFQIRVNGPKAAPLYNFLKAKKGGFCGSRIKWNFTKFLVDKEGQVIGRYGTSTSPLSIEG
DIQKALNAQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic, 2 ESTs (TIGR TC14681) and 4 ESTs from Unigene (BU017007, CD848888, DY920274, DY919597). Cultivar="RHA280" and "ANN1312".
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST