Entry information : PtPrx05 (POPTR_0004s02230 / Potri.004G023100)
Entry ID 3083
Creation 2008-04-25 (Christophe Dunand)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx05 (POPTR_0004s02230 / Potri.004G023100)
Name (synonym) PtPrx05 (POPTR_0004s02230 / Potri.004G023100)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx05
start..stop
S start..stop
PtPrx06 653 0 1..327 1..327
PtPrx91 557 0 1..327 1..327
PtPrx55 547 0 1..327 1..327
MePrx97 471 1e-168 7..327 6..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1520132..1520353 222 N° 2 1520469..1520654 186 N° 3 1520736..1520901 166 N° 4 1520995..1521404 410
join(1520132..1520353,1520469..1520654,1520736..1520901,1520995..1521404)


exon

Literature and cross-references PtPrx05 (POPTR_0004s02230 / Potri.004G023100)
DNA ref. Phytozome 12:   Chr04 (1520132..1521404)
Omic ref. ePlant:   Potri.004G023100
Protein sequence: PtPrx05 (POPTR_0004s02230 / Potri.004G023100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35576.47 (32683.9) Transmb domain:   %s   o10-27i
PI (pH):   %s   9.23 (9.24) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSLKLSSGLIFIQLVLLAFVFNSANAQLKVGFYKDTCPQAEAIVKGVMDQVLKVAPSLSGPLLRLHFHDCFVRGCDASILLNSCAGQAEKDSPPNLSLRGYQVIDRVKAALEKKCPGVVSCADILAIVARDVTAATLGPSWRVETGRRDGRVSNISEPITNLPPFFANISQLLTQFRSKNLSKKDLVVLSGAHTLGTSHCSSFDSRLYNFTGKGDTDPTLDSEYIARLKKICKAGDQITLVEMDPGGVRTFDNSYYKLVANRRALFHSDAALLDNNYTKAYVKLQSVESDGSTFFKDFGVSMRKMGRVEVLTGKAGEIRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTTTAAAGCTTTCTTCAGGTTTAATCTTTATTCAATTGGTTTTACTGGCATTTGTCTTTAACTCGGCAAATGCGCAATTGAAGGTAGGGTTTTACAAGGATACATGTCCACAA
GCTGAAGCTATTGTGAAAGGGGTTATGGATCAAGTGTTGAAAGTTGCTCCTAGTCTTAGTGGCCCTTTGTTGAGGTTGCATTTTCATGACTGCTTTGTTAGG
GTACGTAAGCCATTAATC
CATTTCTGATCATTTGAAATTCTGAAACAGTTTATTCTTTTTTGCTTGAATTATAGCAAAACCCTTACGATCACTAGCTAATTATATATTTCTACAGGGTTGTGATGCGTCAATTCTTTT
GAACTCTTGTGCTGGCCAAGCTGAAAAAGATTCACCTCCAAATTTAAGCCTTAGAGGATATCAAGTTATTGACAGGGTCAAGGCTGCGTTAGAAAAAAAGTGCCCTGGAGTGGTTTCCTG
TGCAGATATCTTGGCCATTGTGGCTAGGGATGTCACGGCCGCG
GTAAGAAATATCTTTCAAATTCATTAGAGAGTTTCTTTTGCAAGCAAAATGTTTGTATTTAACAAAACTTTATCCTC
TCAGACTTTGGGACCATCCTGGCGAGTTGAAACTGGAAGAAGAGATGGAAGGGTGTCTAACATTTCAGAGCCTATAACAAACCTGCCACCATTTTTCGCAAACATTTCTCAATTGTTAAC
ACAATTTCGTTCTAAGAACCTAAGCAAAAAGGACCTTGTAGTGCTCTCAG
GTATATAAACATTTCAAGTTCAGTTTCTTCATAGAGATTCTTGAAACAAGAAATTGAACTTGAATAATTC
TATTTATTCTTCCTGGCACGTAGGTGCGCACACCCTTGGCACTTCTCATTGCTCTTCTTTCGATTCTCGGCTTTACAACTTCACTGGAAAGGGTGACACTGATCCCACACTGGATTCAGA
ATACATAGCACGGTTGAAGAAAATATGCAAGGCAGGAGATCAAATTACGCTAGTCGAAATGGATCCTGGAGGCGTCAGGACATTCGACAACAGCTATTATAAACTCGTAGCTAATAGAAG
GGCACTTTTCCATTCTGATGCAGCTCTCCTTGACAACAATTACACAAAAGCTTATGTTAAACTTCAGTCTGTTGAAAGCGATGGATCCACTTTCTTCAAAGACTTTGGTGTTTCCATGAG
AAAAATGGGAAGGGTTGAAGTTCTTACTGGTAAAGCTGGTGAAATCAGGAAAGTTTGCAGCAAAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAGTTTAAAGCTTTCTTCAGGTTTAATCTTTATTCAATTGGTTTTACTGGCATTTGTCTTTAACTCGGCAAATGCGCAATTGAAGGTAGGGTTTTACAAGGATACATGTCCACAA
GCTGAAGCTATTGTGAAAGGGGTTATGGATCAAGTGTTGAAAGTTGCTCCTAGTCTTAGTGGCCCTTTGTTGAGGTTGCATTTTCATGACTGCTTTGTTAGG
GGTTGTGATGCGTCAATT
CTTTTGAACTCTTGTGCTGGCCAAGCTGAAAAAGATTCACCTCCAAATTTAAGCCTTAGAGGATATCAAGTTATTGACAGGGTCAAGGCTGCGTTAGAAAAAAAGTGCCCTGGAGTGGTT
TCCTGTGCAGATATCTTGGCCATTGTGGCTAGGGATGTCACGGCCGCG
ACTTTGGGACCATCCTGGCGAGTTGAAACTGGAAGAAGAGATGGAAGGGTGTCTAACATTTCAGAGCCTATA
ACAAACCTGCCACCATTTTTCGCAAACATTTCTCAATTGTTAACACAATTTCGTTCTAAGAACCTAAGCAAAAAGGACCTTGTAGTGCTCTCAG
GTGCGCACACCCTTGGCACTTCTCAT
TGCTCTTCTTTCGATTCTCGGCTTTACAACTTCACTGGAAAGGGTGACACTGATCCCACACTGGATTCAGAATACATAGCACGGTTGAAGAAAATATGCAAGGCAGGAGATCAAATTACG
CTAGTCGAAATGGATCCTGGAGGCGTCAGGACATTCGACAACAGCTATTATAAACTCGTAGCTAATAGAAGGGCACTTTTCCATTCTGATGCAGCTCTCCTTGACAACAATTACACAAAA
GCTTATGTTAAACTTCAGTCTGTTGAAAGCGATGGATCCACTTTCTTCAAAGACTTTGGTGTTTCCATGAGAAAAATGGGAAGGGTTGAAGTTCTTACTGGTAAAGCTGGTGAAATCAGG
AAAGTTTGCAGCAAAGTTAATTAA

Retrieve as FASTA