Entry information : PtPrx20 (POPTR_0001s22610 / Potri.001G218500)
Entry ID 3098
Creation 2006-05-22 (Claudia Cosio)
Last sequence changes 2010-08-03 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx20 (POPTR_0001s22610 / Potri.001G218500)
Name (synonym) PtPrx20 (POPTR_0001s22610 / Potri.001G218500)
Class Class III peroxidase     [Orthogroup: Prx024]*
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx20
start..stop
S start..stop
MePrx79 409 4.96e-144 1..330 1..323
LuPrx26 387 1.96e-135 24..331 12..316
HaPrx42 385 1.59e-134 7..333 6..327
HaPrx24 384 6.65e-134 9..334 6..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3098' 'join(21511020..21511262,21511361..21511540,21511713..21511872,21511982..21512439)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21511020..21511262 241 N° 2 21511361..21511540 178 N° 3 21511713..21511872 158 N° 4 21511982..21512439 456
join(21511020..21511262,21511361..21511540,21511713..21511872,21511982..21512439 )


exon

Literature and cross-references PtPrx20 (POPTR_0001s22610 / Potri.001G218500)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_1 (21511020..21512439)
Omic ref. ePlant:   Potri.001G218500
Protein sequence: PtPrx20 (POPTR_0001s22610 / Potri.001G218500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (319)
PWM (Da):   %s   37563.92 (34788.5)  
PI (pH):   %s   8.14 (8.20) Peptide Signal:   %s   cut: 28 range:28-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEMPRVAAALALALSLIFVNMASQCSGQLQFGFYNGKCKDRNGFQ
RNVEDIVKQKVKARFSTDTTIVAALLRMQFHDCFVN
GCDASILLDVPNGEKTAPPNLSVRGYDFIEEIKTEIENTCPGVVSCADIIVMATRDAVVESRTGWYPVQTGRRDGRVSSAQNVKLPSPSIPIPQAIAAFNSKRLSTIDMVYLLGGGHSVG
VAHCGLFQNRLYDFKNTGHPDPTMNTTLLKTLQTLCPQNSGSTNSANLDQDPLKSSSVDKSYYEQIRLGNGILEVDQQLALDSNTRFSVARIAESNDFSFQFGRAMIKLGAVDVKIGKDG
EIRKRCAAVNSPNGNSGGNIFNIFG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGCCAAGAGTAGCTGCTGCTTTGGCACTAGCACTTAGCCTCATCTTTGTGAACATGGCTAGCCAATGCAGTGGTCAGTTGCAGTTTGGATTCTATAATGGAAAATGCAAGGAC
AGAAATGGCTTTCAGAGAAATGTTGAGGATATTGTCAAGCAGAAAGTAAAGGCAAGATTCAGTACAGACACAACAATAGTGGCTGCTCTTCTTCGCATGCAATTTCATGACTGTTTTGTC
AAT
ATGTAAGAAGGTTTTGCAATCCCTTTCAACGTTAATTTGTTTTAGTACTCTTTGCTCAATACATGCACAATCTAATGCAATTTTTTGGGGGTGTTGAAAGGGATGTGATGCATCTAT
ATTACTGGATGTGCCAAATGGTGAGAAAACTGCACCTCCAAATTTAAGTGTGAGGGGCTATGACTTCATCGAGGAAATAAAGACGGAAATTGAAAATACATGCCCGGGAGTCGTCTCTTG
TGCTGATATTATAGTAATGGCTACCAGAGATGCTGTTGTCGAG
AGGTGCATAACTTTTTTCTATTCCCTTTCAGAATCAATGCATGCGTCTCATTCTTAACAAAAGAATTGAACTGTAAA
CAAACATTAACAAAATTTATTCAGGGGTCAAAAGAGTAGGATAACAAAAGAATTGAGTGATAAATGCTTGTGCTCATGCATGCAGAGTGATATGAAGTCAAGGACAGGATGGTACCCTGT
ACAAACAGGAAGAAGAGATGGTCGTGTATCTTCTGCTCAAAATGTGAAACTCCCATCTCCAAGTATCCCAATTCCTCAAGCTATTGCAGCATTTAATAGCAAAAGACTGAGCACTATTGA
CATGGTTTATCTTCTTG
TGGTATGTGATGATGCATTTTTCCATTTCTAATTCTCTTTGAAACTACATGTGATATTACATTTCCAAGCACATTACTAATTTGTCTTTTGATTCTTCTGATG
ATGTATAGGAGGTGGTCACAGTGTCGGGGTAGCACATTGTGGTTTATTCCAAAATCGTCTTTATGATTTCAAGAACACTGGCCACCCTGATCCAACCATGAATACAACACTACTGAAAAC
CCTACAAACTCTTTGTCCTCAAAATTCTGGCAGTACCAACTCAGCTAATCTCGACCAGGATCCTCTCAAGTCTTCTTCAGTGGACAAATCTTACTACGAGCAAATACGTTTAGGTAATGG
GATTCTCGAAGTTGATCAGCAGCTAGCTCTGGATTCAAACACCAGATTCTCAGTGGCAAGAATAGCTGAAAGCAACGACTTCAGCTTTCAATTTGGTCGGGCCATGATTAAGTTGGGAGC
TGTTGACGTCAAGATTGGCAAAGATGGGGAGATCAGGAAAAGATGCGCAGCTGTTAATTCACCTAATGGAAATTCTGGTGGAAATATTTTTAATATATTCGGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGCCAAGAGTAGCTGCTGCTTTGGCACTAGCACTTAGCCTCATCTTTGTGAACATGGCTAGCCAATGCAGTGGTCAGTTGCAGTTTGGATTCTATAATGGAAAATGCAAGGAC
AGAAATGGCTTTCAGAGAAATGTTGAGGATATTGTCAAGCAGAAAGTAAAGGCAAGATTCAGTACAGACACAACAATAGTGGCTGCTCTTCTTCGCATGCAATTTCATGACTGTTTTGTC
AAT
GGATGTGATGCATCTATATTACTGGATGTGCCAAATGGTGAGAAAACTGCACCTCCAAATTTAAGTGTGAGGGGCTATGACTTCATCGAGGAAATAAAGACGGAAATTGAAAATACA
TGCCCGGGAGTCGTCTCTTGTGCTGATATTATAGTAATGGCTACCAGAGATGCTGTTGTCGAG
TCAAGGACAGGATGGTACCCTGTACAAACAGGAAGAAGAGATGGTCGTGTATCTTCT
GCTCAAAATGTGAAACTCCCATCTCCAAGTATCCCAATTCCTCAAGCTATTGCAGCATTTAATAGCAAAAGACTGAGCACTATTGACATGGTTTATCTTCTTG
GAGGTGGTCACAGTGTC
GGGGTAGCACATTGTGGTTTATTCCAAAATCGTCTTTATGATTTCAAGAACACTGGCCACCCTGATCCAACCATGAATACAACACTACTGAAAACCCTACAAACTCTTTGTCCTCAAAAT
TCTGGCAGTACCAACTCAGCTAATCTCGACCAGGATCCTCTCAAGTCTTCTTCAGTGGACAAATCTTACTACGAGCAAATACGTTTAGGTAATGGGATTCTCGAAGTTGATCAGCAGCTA
GCTCTGGATTCAAACACCAGATTCTCAGTGGCAAGAATAGCTGAAAGCAACGACTTCAGCTTTCAATTTGGTCGGGCCATGATTAAGTTGGGAGCTGTTGACGTCAAGATTGGCAAAGAT
GGGGAGATCAGGAAAAGATGCGCAGCTGTTAATTCACCTAATGGAAATTCTGGTGGAAATATTTTTAATATATTCGGTTGA

Retrieve as FASTA