Entry information : PtPrx29(POPTR_0007s02570 / Potri.007G122200)
Entry ID 3107
Creation 2006-06-12 (Claudia Cosio)
Last sequence changes 2010-06-22 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-05-15 (Catherine )
Peroxidase information: PtPrx29(POPTR_0007s02570 / Potri.007G122200)
Name PtPrx29(POPTR_0007s02570 / Potri.007G122200)
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx29
start..stop
S start..stop
PtPrx28 654 0 1..327 1..327
PtPrx77 611 0 1..327 1..327
RcPrx10 530 0 1..327 1..327
MePrx106 518 0 1..327 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14053135..14053356 222 N° 2 14049159..14049347 189 N° 3 14048908..14049073 166 N° 4 14048425..14048831 407
complement(join(14048425..14048831,14048908..14049073,14049159..14049347,1405313 5..14053356))


exon

Literature and cross-references PtPrx29(POPTR_0007s02570 / Potri.007G122200)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr7 (1511729..1513328)
Omic ref. ePlant:   Potri.007G122200 (14048425..14053356)
Protein sequence: PtPrx29(POPTR_0007s02570 / Potri.007G122200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (301)
PWM (Da):   %s   35663.26 (32839.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.47 (8.38) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIQKLFAVCFLQLVFAFLLAGLTNAGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFIRGCDGSVLLSSTEKNQAEKDAIPNKTLRGFNVIDAVKSALEKNCPGVVSCSDVLALVARDAVLMIGGPHWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIGHCTIISNRLYNFTGKGDTDPSLDPRYAAQLKKKCKPGNSNTVVEMDPGSFKTFDEDYYNIVAKRRGLFRSDAALLDDAETRDYVKFQSRTQGSTFAQDFAESMVKMGYIGVLTGEQGEIRKRCAVVN

Retrieve as FASTA  
Remarks Complete from genomic (chromo 7, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTTTCGCGGTCTGCTTTCTTCAACTCGTTTTCGCCTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGGCTGCAACTCGGATTCTACCAGAGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTATCGTTACGTCTCTAGGGACCGAACCCTTGCTGCTCCTCTGCTACGAATGCATTTCCATGATTGCTTTATCAGG
GTAAGCTTTTAAGCTGAA
GTACTAGTATGCAATTTACACAGTATGTATCTGATATCATCATCATCATCTCAATGTTACCTTGCCACAAAAGCACTTGGAAATCAAGCGTTTTCATCTTGTTTAGGAAACCACACAATT
TCATATCCTAACAAGTTATGCTTTCCAGGGATGTGAGGGTTCTGTGCTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTAAGAGGGTTCAATGT
CATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTGGTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACGCGGTTCAATTCACACAGTTGTGAAACATAATTTA
TCACCACTGATTAACTGGATCATTATGCCGATGCTTAACCAGTTTTTCCATTCAGATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGA
GGCTTTATTCAATTTACCATCTCCTTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAGGTAGTTTTCGTAACAAAAA
AAGCTATCTATTAAGCAAAATATCAGCGTATTTACTTGGAATATGTTTTGGTGACAGGAGGACACACCATAGGAATTGGACACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAG
GCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAATGTAAGCCTGGAAACTCCAACACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCG
ACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCA
CTTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGGAAACATTGTGCTGTTGTGAATTAAATCGATCTTCTATTGA
TTTCCTGAAATGCACGTGTGATTTCATTTGTATTTGTTTCATTTATTTTCCCCCACATTTGCAACCCAATTAGTTGCAGGATGTACTTCATAATTTGAGGTTTTGCCTTCATGTTATTTC
TTGTGATTTATTCAATATTTTCTTCATACGAATATAAACATCCACTACCTTCATAGTATTTTAATACCTGCTACAGTTTCTTTCACTCTTTTGGCTAGGCCATGAATATATGCATGCTTG
GGCAGACTGCAACTCCCATGAACATACCCAACATCTTCACAGAAATTTACCTAAGTGTACAGCAAGTATTCAATCTGGAAGAACATTTTTATATGTGCTCCTCGTAAAATCTCATTACCC
AAATGCCTCTACTTATTTGTCTATAGAGGTCAGATCGGCTGACTTATTTATCTATTGAACTGATGCTAAAAATATGTCTCAAAACCAAGTGAGATTGTACCTCCTTAGAACTTGTAATGC
AGTGCACCAATCTTTAATATCTTACCTGCAATTGCCAGAATGCCAACCATTATTTTCTTGATTTTCATTCAAAACAGGAAAAAAAAATCACCTGTAAATAAATCCAGTACAGTCAAATTT
TGGATGCACAAGCTAGTTGAAATCAAGAAGGGTGCCAGTCCAATTAATTCATAATATTCATGCATAATCTTCACCATTTTTGCCAGCCAGTTCATAAGCATTTTTAGGAGTTGTTGAGTC
TTTCTTTTGATGCCTGTCAGGAACAGAATCGTGTAAACCAGCTTGTAATTTCTTTTTCTGCAGGGTGATTTTAAATGAACGGCTAGAAAGTTGGGTGTTTGAAGAATTAGAAGGAACAAA
AAGACCTCAAAACTCACGTTGGAAAAATTAGAAATACTGTTTTTATGGTTAAGTTCATCCTGGAAACCTTTTGTGCGTTGTCTGAATCATGATTTCATGTATCATGCACTTCTAAAATAT
AAAACAAACAGGTAAATAAGCCTCTTACACACATTAAGTGTCTGCTAATTGCATATGTTTCTCATGTTTCCTCGTACCAAAATTGACTGAAACTAATTTTTGTTTTAAATGGTGATCTTA
TTAGAAGGGCTGCTGAAAGAACATGAGATGTTTTGAACTCCATTAACTCCATTTATCATCTGATCAATCAGGGATTAATCTGCAACAAATTTCTTCCTCAGAAACTGGATATTGGCATAT
GATACCTCAGTGTGATAGAACCAATGAACAACATGGTGTTAACTCATCTGGAAAAGTCCATGAATTAATTACTAGGGAAAAATAAATAAGTAAAATGAAGTCCTTATATATGTTCTGAAT
TGTTCAAGCTTCTCAAAGCCTTTAATCTCTTCAGTTTCGTAAAAGGGTGAGAACTGAGAATTCCCTACGTCGTCTTCACACAGTTTGCCACAGTATATTGTACAGTTAATGGAAACATGC
AGAGGACTTGGATGTTTTTCTAACAAATCATAAAGTGAATCCTGCTTCTTACACATGCATAATGTCCTGAGACACCTAATGGAAGCATCCAGAGGAGTAAATTCTGTCTTCAAACGCTAA
TGCAAGTGAATGGTCATGCTGAAGAATCACTTAGCTCAACTGCATTTCGCATGTGGTTTCTTCGAAACTAAGCTCTATCGATACCTTCCAAATCCTGGAACCAATTACTTTGGAAATTGT
AACTCAAGGCCAACAAGGTAGAGAAGATCAGAACCAGTCGTAGCTACATATATTGAATTACAGAATGCCGTTTATACATTGCAGGATTGAACAGTACAGTTTGCTTAAACCTTGCGTTCA
CATATTTAGCCCATTTCATTTCTTACAATGTTGCTACTGCTCTTTACAGCCATTTCACTACCATCAATAGACCTTTTGGGAAATTAACACTTGTTTTTTTATCAGGCCTTTGTGCGTAGC
AACTTCTTGTTATGTATCCTGAATGGGCACAATAATATCTATAATCTATGTTAGATTGTTTTCTGTGGCAATGCAATGGGAGAATGTTTAATGCAAGTAGAGATTTTTCAATGTTTTGAT
TACGAGTGTCAGCTAAAGATTCTTAGGGCCAACACATATTGTAGCCGAGTTGTGGTGTGAAGCGAAACCATCCTCACAGGACGTGTTTCCATTTTTGAAGTACTTGGAGTTGATCTGTTC
AATAGGAGAATGTTTAATGCAAGTGGGGCAAACGTGCAATCATATTACACACAGCTGACAGTTTGTACAATGACGCTGTCAAAGACCTCAGCTTGACTATAAAAAGCCGGAAAAATTATT
GTGTTCCAAACCATCTCAGCCTGTAGAACAACTTCAAAACTCCTGTTCACAGATAATGGCTATCCAAAAGCTTTTTTCAGTCCTCTTTCTTCATCTGGTTCTCGTTTTCCTGCTAGTAGA
ACTCACTAATGCAGGGGGGTTGCAACTCGGATTTTACCGGAGAACCTGTCCTGATGCAGAGATTATTGTACATGAGACCCTTCACCGGTACATTTCTAGGGACCCAACCCTTGCCGCTCC
TTTGCTAAGAATGTATTTCCATGATTGTTTCATCAGGGTAAGCCCTTAAGCTACGCTACTGTTCAATTCACACAGTTGTGAAACATAATTTATCATATATCATTATTTTCAACATTACAT
TGCTGCTTAAGCACACGTAGAACAATATCCTAACAAGTTGTGGTTTCAGGGATGTGATGGCTCTGTGCTCCTAAGTTCTACAGAGAAAAATCAAGCTGAGAAAGACGCGATCCCGAATAA
AACCTTAAGAGGATTCAATGTCATTGATGCTGTAAAATCTGCACTGGAGAAGAATTGTCCTGGTGTGGTTTCCTGTTCTGATGTCTTGGCCCTGGTGGCTCGTGACGCAGTCCTAATG
GT
ATTAAATCTTCCAACACAAAATTTATCTCCACTAATAAACTGCACCATATGCGCATGTGCTTAATCAAAGCCTTTCCTTCCAGATTGGCGGACCACATTGGGATGTCCCCACGGGACGCA
GAGACGGAAGAGTGTCGATTGCCAATGAGGCTTTATTCAATCTACCATCTCCTTTCGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAG
TTTTATCAG
GTAGTTTTCGTAACATAAAAAGCTGTCTATTAAGCAAAATATCAGCGTCTTTACTTGGAATATTTTTTGGTGACAGGAGGACACACCATAGGAATTGGACACTGTACCATA
ATCTCGAACAGGTTGTACAATTTCACAGGCAAAGGTGATACTGACCCTTCATTGGACCCAAGGTACGCTGCTCAACTGAAGAAAAAATGTAAGCCTGGAAACTCCAACACAGTCGTTGAG
ATGGACCCTGGGAGCTTCAAAACTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGACTACGTC
AAGTTTCAGTCAAGGACACAAGGATCCACCTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGCTACATTGGAGTCCTGACCGGCGAACAAGGTGAAATCAGGAAACGTTGTGCT
GTTGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTTTCGCGGTCTGCTTTCTTCAACTCGTTTTCGCCTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGGCTGCAACTCGGATTCTACCAGAGAGCATGTCCTGAT
GCAGAGCTTATAGTCCATCAAACTCTTTATCGTTACGTCTCTAGGGACCGAACCCTTGCTGCTCCTCTGCTACGAATGCATTTCCATGATTGCTTTATCAGG
GGATGTGATGGCTCTGTG
CTCCTAAGTTCTACAGAGAAAAATCAAGCTGAGAAAGACGCGATCCCGAATAAAACCTTAAGAGGATTCAATGTCATTGATGCTGTAAAATCTGCACTGGAGAAGAATTGTCCTGGTGTG
GTTTCCTGTTCTGATGTCTTGGCCCTGGTGGCTCGTGACGCAGTCCTAATG
ATTGGCGGACCACATTGGGATGTCCCCACGGGACGCAGAGACGGAAGAGTGTCGATTGCCAATGAGGCT
TTATTCAATCTACCATCTCCTTTCGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAG
GAGGACACACCATAGGAATTGGA
CACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAAGGTGATACTGACCCTTCATTGGACCCAAGGTACGCTGCTCAACTGAAGAAAAAATGTAAGCCTGGAAACTCCAAC
ACAGTCGTTGAGATGGACCCTGGGAGCTTCAAAACTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCTATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACA
AGAGACTACGTCAAGTTTCAGTCAAGGACACAAGGATCCACCTTTGCACAAGATTTTGCTGAATCCATGGTGAAAATGGGCTACATTGGAGTCCTGACCGGCGAACAAGGTGAAATCAGG
AAACGTTGTGCTGTTGTGAACTAG

Retrieve as FASTA