Entry information : PtPrx35 (POPTR_0007s05100 / Potri.007G096200)
Entry ID 3113
Creation 2006-05-31 (Claudia Cosio)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: PtPrx35 (POPTR_0007s05100 / Potri.007G096200)
Name (synonym) PtPrx35 (POPTR_0007s05100 / Potri.007G096200)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx35
start..stop
S start..stop
PtPrx59 610 0 1..330 1..330
RcPrx30 566 0 1..330 1..329
MePrx22 555 0 1..330 1..328
MePrx63 551 0 1..330 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12232194..12232400 207 N° 2 12232540..12232731 192 N° 3 12233537..12234130 594  
join(12232194..12232400,12232540..12232731,12233537..12234130)


exon

Literature and cross-references PtPrx35 (POPTR_0007s05100 / Potri.007G096200)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr07 (12232194..12234130)
Omic ref. ePlant:   Potri.007G096200
Protein sequence: PtPrx35 (POPTR_0007s05100 / Potri.007G096200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (311)
PWM (Da):   %s   36370.13 (34454.1)  
PI (pH):   %s   5.26 (5.26) Peptide Signal:   %s   cut: 20 range:20-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLLAAFLLLVSMGLTSASTVPLRPGFYSETCPEADFIVKDVMRRNMIREPRSAASVMRFQFHDCFVNGCDASVLLDDTPNMLGEKLALSNIDSLRSYEVIDEVKEELEKVCPGTVSCADIIIMASRAAVVLSGGPDWDVKLGRVDSLTASQEDSNNIMPSPRANASLLMDLFERFNLSVKDMVALSGSHSIGQARCFSIVFRLYNQSGSGRPDPAIETKYREKLDKLCPLGGDENVTGDLDATPATFDNRYFKDLVAGRGFLNSDQTLYTFPETRKYVTLFSKNQQAFFRAFVEGMIKMGDLQSGRPGEIRSNCRMANSRPVRVLTES*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGTCACTT TTTGTGGACA ATGAATTGCT AAAATATGTT CAAATCAGCA ATAGTTTAAG GGTTAATTAG AGAAAACTCA ATAAATCAAG GATGTATTAA ACCTCAAATT AATTATAGAA  TTGTCGTAAG AGAAGGGTCA GTCATTAAAA TGGTAACCTA TCTACTAGAG CAGCACCGGG CTCGGCAAAT CAACTAGCTA GCTCAACAAC GCGTCTTTGT TTTTCCTTTT CTGGCATTTT  GCAGAGTACA GCTGCTTTAT TTCAGAAGGT GTAATGGTTT TTGCACCATA TTTGACTCTT TTGCTAGAAA AGGGTGGCTG AGCTTGTTGA TACCAAGAAA GATAAGGCAG GGCATCTGTT  TTTTTTATTT AAAAAAAAAA ACTATTTGAA AATAAAAACA AATAAAAAAC TGTTTAAGAG ATAATAAAAT ATTATTTTTA AGATATTTAT TTGTTCTAAA GACAACACCT CTAGAATTCG  ACTAAGTCAT CGAAAGTTCT AAACATCTAA AAAAAATAAC AAGGAAAGAT AAAAGAAAAA AATATATTTT TATATTTTTT CTCTATGTTG TAACAAGTTT ATATAGACTT GAAATATTAT  AATCGTTAAT AAAATAATTG TAATTTAAAT TAAACTAAAT AATTACTGTT AAGTTTTATT TTAACAATTA TAAATATTAA AATTAATTAA AAAAAATCCA GGAAAAAAAA TTAACCTCAC  TTTTCAAATA CCATCTTTTT TATCCAAAAA CTCATTAGAA TTATCACGTA AGTTAACACT TACAGAGCAC GGGGGGCCAA TTGTCGAGTC AAGAGTGAGT AAGGACCCCC ACCTTGCTCT  GCCCTCACAA GGGACACTTT CAGTTCCTCA CTGCATCTTC AATAGCCAAT TGCCTTATCT TGCTCTCTCA GTGTCCTAAC AAAAACTGTA ATATCCTGAC ACCCACACCA CACGAGAATC  TATACCCCTT TTTCCATGCC CATCATCATT CCATTGTCTC ATACATAGAT ATGTGCGCAT GTGCAAATTG TTTTTTTTTT TTTTTTTCCG TTCATGTCAT GTGAGAGAAC TTGTTATAAA  GTATGCTAAA TTGCGCGTAT AACTCTAGAT ATAGATTATT GTGATAGTAA AATTTATATG GATATGTTAT GTAATTAAAA GAATTATAAG GGATGTTCAT GTTATATATT TTATTTTTTA  ATCGAAAAGT TACCGGCACG TGTTCCCCAC ACTCTAACGA GTGGGCGGCG CCCGCGCCAT TAAAAAGACG TTTGAGACGC TTTACGGTGG TCAAATCTGG GCATCTATTG TGTCTCTAGA  TATATAGACA TGCCCTCTTT CACATGGTGC GGCGTGTGTA AACATATCAT GGTTGGATTG CCGCTGATAA TCGATTGTTT ATGTTTTTTC TTTCTTTTCT CTCTCTTGAC AACTAAAGTG  CATTATTGTC TTCTGTTTGT TTATTGTTTG CTTGGGTCTA GCATTGATTG TTAGACCCAA GCATCTTAGA TGTGGCGTGG TACCTTGGGT CTGGCAACTA TGTTAAATCA AAGCTACTTA  GATCTAACAA CATTGCTAGG TCCAAGAACC TTGAGTCTGA CAATAATGTT TGGTGCCAGA CCCAGGCATT ATCTGGTATC TATACATGGT TGTCAGACCC AAAATATTTA AAAATATTTT  TTATAAACCA ACCTCAACTA AAAGTACTTT TTATAAAACA ATTTTTTTTA AACCACAACC ACAACAGCTA CCGCAATACC AAACACACTC ATATATCATC CTAACGTGAG GAAGGACTTT  TCAAAGTATT CTTAAGAAAC GCAATCGCCT CATCACAATA ACATTAACAT ACCATGAATA GATCCCCATC CATGATATAT ACATGAAGGC ATACGGCCAA CTAGTTTAAA AGTCCTTACG 
CCAGACACCA AAATTAGCCC ATATCTCTCA CTCACAAACT ATCAACTAAA CTATAGTGCC TGAAAAATAA AAATTATAAA 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCCTCTCCTTGCAGCCTTTCTCTTGCTCGTATCCATGGGCTTGACCTCTGCCTCTACCGTGCCACTCCGGCCTGGCTTTTACTCCGAGACGTGCCCGGAAGCTGATTTCATAGTC
AAGGATGTGATGAGGAGGAACATGATTAGAGAACCAAGAAGTGCTGCCTCAGTCATGCGTTTTCAATTCCATGATTGTTTTGTTAAT
GTAAACTTTATTATACAAACCAAAAACTTAATA
CATGTTTTCATGTCAATCTTGCATTATTATTAGTATTATTGTTATTATTATTATTATAAAGATATTAATTCATTTTTCTTTGATGGGTTTTCTTTTTTCCTTGCAGGGTTGTGATGCTTC
TGTGCTGCTTGATGACACACCAAACATGCTAGGAGAGAAGCTTGCTCTGTCCAACATAGATTCTTTAAGGTCTTATGAAGTTATTGATGAAGTTAAGGAAGAGTTAGAGAAGGTTTGTCC
AGGGACGGTTTCTTGTGCAGATATAATTATCATGGCCTCTAGAGCTGCTGTTGTCCTG
GTAATAAATTTGCTCCTGTTATGTAAGACTTCTGCGTTTTTTTGCTATAATTCTTCACAGAA
CAAAATTATAACCAAAAAAGTCACTAGCAACTTGGCCATAAGAAGACTGGGTCTTGTGTTGGCTAGCCACCTGCGCACTAGGCCTATCTCACCGGATATTCTGCGAAATGGGTCCTTTTT
GTCCAACTTTTGTCCTCTACTGCTCATACAATATGAACAGAACGACGGCATAATTATGGTCTTTACAAAAGGTCGTTTTTTGCCCTTTTTTCTTGATTCATTTCGGTGGTGACTATCGAG
GATTGTATTTGTACTTGAATTTGAGGCCTACCCTCTCCCCTTCTTAGTGGAGTAATACTATATCCAACATTCTGCTAACGTTAAACATCTGGTCACAAACATTGCATGTGTGGGCGTGGC
CCTTTAATCTAGTCTTCTTGTGAAAATTATAGAGGGGCAATAATTGTAGCTTTTTGAAGCTCGCAGTTTGACAATAATTGTATCCTAGAAGACCATCCCTTTGAATCCAGTACTGGGTCT
CTTTCACTGTTCAACATGGAAATCTTGCAGTTTAAGGTTTAGCTGATACCAGCATTTTTCCGGATATGCCGGTATCTAGGCTTTCCCGGATGCTGGAATTATAGACTTCCTCTCAAGACA
ATCTCATTGTTTTTAAGTAATAAAGAGAAAAATCTCAGAAGATTAGACAAGACTTGGTCAGACAGAACTCTTTGCTAAAGAACTGATTTTTAGCCTCTCTTTTTTATTTGAAATTTTTTG
TTCTATTCATTGTATTGGATTAGAGTGGAGGACCAGATTGGGACGTGAAGTTAGGGAGAGTAGACAGCTTAACAGCTAGCCAGGAGGACTCCAACAATATCATGCCAAGTCCAAGAGCTA
ATGCAAGCCTTCTCATGGACCTCTTCGAAAGATTCAACCTCTCTGTCAAGGATATGGTAGCCCTCTCAGGGTCACATTCTATTGGCCAAGCTCGGTGCTTCTCCATAGTGTTCAGGCTCT
ATAACCAATCAGGCTCCGGCAGACCTGACCCAGCAATTGAGACAAAGTACAGAGAGAAGCTAGACAAGCTTTGTCCACTTGGTGGAGATGAAAATGTAACTGGAGACCTTGATGCAACAC
CAGCTACATTTGATAACAGATATTTCAAAGACTTGGTTGCTGGGAGAGGGTTTCTAAATTCTGATCAGACCCTTTACACATTTCCTGAAACGAGGAAATACGTAACCCTTTTTAGCAAAA
ATCAACAGGCATTTTTCAGGGCCTTTGTCGAGGGCATGATAAAGATGGGCGACCTGCAGTCTGGGCGGCCTGGAGAGATTAGAAGCAATTGTAGGATGGCCAACAGCCGGCCTGTTCGTG
TACTCACGGAGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCCTCTCCTTGCAGCCTTTCTCTTGCTCGTATCCATGGGCTTGACCTCTGCCTCTACCGTGCCACTCCGGCCTGGCTTTTACTCCGAGACGTGCCCGGAAGCTGATTTCATAGTC
AAGGATGTGATGAGGAGGAACATGATTAGAGAACCAAGAAGTGCTGCCTCAGTCATGCGTTTTCAATTCCATGATTGTTTTGTTAAT
GGTTGTGATGCTTCTGTGCTGCTTGATGACACA
CCAAACATGCTAGGAGAGAAGCTTGCTCTGTCCAACATAGATTCTTTAAGGTCTTATGAAGTTATTGATGAAGTTAAGGAAGAGTTAGAGAAGGTTTGTCCAGGGACGGTTTCTTGTGCA
GATATAATTATCATGGCCTCTAGAGCTGCTGTTGTCCTG
AGTGGAGGACCAGATTGGGACGTGAAGTTAGGGAGAGTAGACAGCTTAACAGCTAGCCAGGAGGACTCCAACAATATCATG
CCAAGTCCAAGAGCTAATGCAAGCCTTCTCATGGACCTCTTCGAAAGATTCAACCTCTCTGTCAAGGATATGGTAGCCCTCTCAGGGTCACATTCTATTGGCCAAGCTCGGTGCTTCTCC
ATAGTGTTCAGGCTCTATAACCAATCAGGCTCCGGCAGACCTGACCCAGCAATTGAGACAAAGTACAGAGAGAAGCTAGACAAGCTTTGTCCACTTGGTGGAGATGAAAATGTAACTGGA
GACCTTGATGCAACACCAGCTACATTTGATAACAGATATTTCAAAGACTTGGTTGCTGGGAGAGGGTTTCTAAATTCTGATCAGACCCTTTACACATTTCCTGAAACGAGGAAATACGTA
ACCCTTTTTAGCAAAAATCAACAGGCATTTTTCAGGGCCTTTGTCGAGGGCATGATAAAGATGGGCGACCTGCAGTCTGGGCGGCCTGGAGAGATTAGAAGCAATTGTAGGATGGCCAAC
AGCCGGCCTGTTCGTGTACTCACGGAGTCTTAA

Retrieve as FASTA