Entry information : PtPrx36 (POPTR_0007s08240 / PT07G07640 / Potri.007G067200)
Entry ID 3114
Creation 2010-01-15 (Christophe Dunand)
Last sequence changes 2014-01-07 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: PtPrx36 (POPTR_0007s08240 / PT07G07640 / Potri.007G067200)
Name (synonym) PtPrx36 (POPTR_0007s08240 / PT07G07640 / Potri.007G067200)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx36
start..stop
S start..stop
RcPrx72 505 0 44..385 2..355
VvPrx90 431 2.81e-151 14..379 11..370
GmPrx168 428 3.25e-150 74..383 70..382
GmPrx270 427 1.67e-149 74..383 64..383
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3114' 'complement(join(6834391..6834632,6834681..6834875,6834970..6835135,6835571..6835768,6836526..6836882))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6836526..6836882 355 N° 2 6835571..6835768 196 N° 3 6834970..6835135 164 N° 4 6834681..6834875 193
N° 5 6834391..6834632 240  
complement(join(6834391..6834632,6834681..6834875,6834970..6835135,6835571..6835 768,6836526..6836882))


exon

Literature and cross-references PtPrx36 (POPTR_0007s08240 / PT07G07640 / Potri.007G067200)
DNA ref. Phytozome 12:   scaffold_7 (6836882..6834391)
Omic ref. ePlant:   Potri.007G067200
Protein sequence: PtPrx36 (POPTR_0007s08240 / PT07G07640 / Potri.007G067200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   385 (362)
PWM (Da):   %s   43361.55 (40733.9)  
PI (pH):   %s   6.27 (5.19) Peptide Signal:   %s   cut: 24 range:24-385
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLMKRKTKTLIVIFIISVILSLKFPSEIEEEERAKREKLEKEE
KTFSVFLQRESATSTRERVVSLADELHGLEYDFYRQNCPQAESIVRSTMARIYMQQNDISFGLLRLLFHDCFIK
GCDASVFLDDSNGNKNRSIERQAAPNKTLRGINEIDMIKEELDNACPGVVSCADSLALATRDAVVLAGGPFYPVFTGRRDSTQSYFDEAMDEIPKPNDNITRTLFLFSRRGFDERETVNL
L
GAHNVGKISCDFIRNRLTNFSGTGQPDASVDHDFLNELRLACQDSNSTNHDGTVASMTSREMRNSTRFDNHYYQNLLGGRGLLFADQQLMADENTARFVAVYASDDGTTFRRDFSRSMV
KMSNLGVLTGTLGQVRNKCSFPTSQS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns + 3' intron). No EST. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGTTAATGAAGAGAAAGACAAAGACACTTATAGTTATCTTCATAATCTCTGTGATTCTTTCTTTAAAATTTCCATCTGAAATAGAGGAGGAGGAAAGGGCCAAAAGAGAGAAG
CTGGAAAAAGAAGAGAAAACATTTTCTGTTTTTCTACAAAGAGAGAGTGCCACAAGTACTCGAGAACGTGTTGTTTCTTTAGCTGATGAGCTTCACGGTCTTGAATACGATTTTTATCGC
CAGAATTGTCCACAAGCTGAGTCCATTGTTAGATCAACAATGGCAAGGATTTACATGCAGCAAAATGATATTTCTTTTGGTCTTTTAAGGCTTCTTTTCCATGATTGCTTCATCAAG
GTA
TGCTATTTTCTTCTTCTTAATTCTTTTTTGTGGGTTTTCCTCAATTGGGTTTCCTTTTCTTTAAATGTTTGTGGCTTTTCTTTTCTCTAAATGTCGATGTGTGCAAGGGTTTTGCTCAAT
TGGGGTTTCTTTGTTGTAGTTCTTTGAGGGTTATTTCAAGTGGCCAGGTTTGTGGATTCTGTGTATTCTTTCCTTTCTTTGAGGGAGTTTGATCACTACACAGTTGTTCCCAAATGGGGA
ATTTGGTTTCTTGTTTGTTGATGATCGTAGGGTTCTTATGAATTTGGGATTTTGTTTTTGTGGTGTGCTTGTTTACACGCAAAGTGTGTCTGCCTCGTGTTTATTAGTTTTATGTTATTT
TTCTGTTGCAGTAGGCTACTTGGCTCTTTAACTTTTCAGGTCTGTATAGGCCTTAAATTGCTTGTTTTATGAAATTTCTTCTCTTGTTATTGTGCATCCTTGCTTCAATTCTTGGCCTGG
TATTCTCAGTTGTTTGGTTCTGTAAATTCTTTGTGGAGACACTTTTCGTGAGGAGCTATCATTGATTGATTGGGCACTCTTTAATTTCTTAGGCAGATAACCACAAATTTGATCTGGATG
CTGAGTCTTGCTATTAACAATAAGAATTCTTGTCATTGCATGTATCTAGATATTAATTCAGATTTCTTTTCATTGTATGTATCTAGATATTGATTCATGGTAATGTTTTTTATATCGTTA
CTTATTACTGATCTTGTGGGATCACTACAATCAGGGGGTTGTGATGCTTCAGTCTTCTTGGATGATAGCAATGGGAATAAAAACCGTTCCATTGAGAGGCAGGCCGCTCCGAACAAGACC
TTGAGAGGTATTAATGAGATTGACATGATCAAGGAGGAGCTTGACAATGCATGCCCAGGAGTAGTTTCATGTGCTGACAGCCTTGCACTTGCCACCAGAGATGCTGTTGTGCTG
GTCTGT
ACTTCTATTGCTTTGTTTTCTTTACATGGACTTAGCACTCAGCAGCTTTAATCTTTTCTTCATTGAGTTCGATATTGAACTAAGCTTTAGTTTTCTTTAGGTTTCGGGTGTTTCTGTTTT
GAAAAAAAAAAACGTAGGAAGAGCTTTCGTTAATGACAAGTATCTGAATCTGACTCCTTCTGAGTGAAAATTTCAGTTAATTAGACTACAAATTTTGCAGTCTATGATCTGAAATGTTTA
ACGGTGATGAAACAGCATTAGGACCTTGTTATTTTGATTGAAGTTTCATCACTTCCCTTCCTTCTGTTTGGTTATTGAAATTTCTGAAACAAAGGAACTGAATCAGTCCTAGTATGCCGC
TGCTTTACTCTCATCCATATCTTCTTCACCATCAACGCTGATGGTGTTCGTTCTTGCCTGATCTTGCAGGCGCTGGTGGTCCATTTTATCCAGTTTTTACAGGCAGGAGAGACAGTACTC
AATCCTACTTTGATGAAGCCATGGACGAGATTCCAAAGCCCAATGATAACATCACCCGAACACTTTTCCTCTTTTCCCGCAGAGGTTTTGATGAAAGAGAAACAGTCAATCTCTTAG
GTA
CTTACTGTGCGTCTTTCTCTCTGTTCCCCTTTATGTCTTCCAAGAAATTATAGAATCAATCATGGACTGAATAAATTTCTTGATTCTATAGGTGTGCTCATAATGTGGGCAAAATCAGCT
GTGACTTCATCCGGAATCGCCTCACTAACTTCTCTGGGACAGGACAACCAGATGCCTCTGTAGATCATGATTTCCTAAATGAATTGAGACTTGCTTGTCAGGATAGCAACAGCACCAATC
ATGATGGAACTGTAGCTTCTATGACATCAAGGGAGATGAGGAACTCTA
GTTCGGCAATGATTTTCCAAGGATCATCCGCTTCTATACCATCCGGAGCACACGTTTTGATAACCACTACTA
TCAGAATTTGTTGGGGGGTAGAGGACTTCTATTTGCTGATCAACAATTGATGGCTGATGAGAATACTGCAAGATTTGTGGCAGTTTATGCTTCAGATGATGGAACAACCTTTAGAAGGGA
CTTTTCCAGGTCCATGGTGAAGATGTCAAACCTTGGTGTCTTGACTGGAACTCTAGGTCAGGTCCGAAACAAATGCTCCTTTCCCACCAGCCAATCTTGA

Retrieve as FASTA