Entry information : PtPrx39 (POPTR_0013s15270 / Potri.013G156800)
Entry ID 3117
Creation 2006-06-14 (Claudia Cosio)
Last sequence changes 2006-06-14 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx39 (POPTR_0013s15270 / Potri.013G156800)
Name (synonym) PtPrx39 (POPTR_0013s15270 / Potri.013G156800)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx39
start..stop
S start..stop
PpePrx54 481 7e-173 1..319 1..322
NnPrx38 468 8e-168 16..319 22..324
VvPrx62 463 5e-166 1..319 1..319
PpePrx43 462 1e-165 1..319 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15935491..15935697 207 N° 2 15935783..15935977 195 N° 3 15936122..15936682 561  
join(15935491..15935697,15935783..15935977,15936122..15936682)


exon

Literature and cross-references PtPrx39 (POPTR_0013s15270 / Potri.013G156800)
Literature JGI.
DNA ref. Phytozome 12:   Chr13 (15935491..15936682)
Cluster/Prediction ref. JGI gene:   56904
Omic ref. ePlant:   Potri.013G156800
Protein sequence: PtPrx39 (POPTR_0013s15270 / Potri.013G156800)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (298)
PWM (Da):   %s   35117.79 (32797.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.04 (9.05) Peptide Signal:   %s   cut: 23 range:23-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAIQSFLYFATLVAILIPVSAQLTPDFYDKVCPQALPIIRKITKQAIRREPRMGASLLRMHFHDCFVNGCDGSVLLDDTANFTGEKTALPNLNSLRGFEVVDQIKSAINQACSANVVSCADILAVAARDSVNLLGGPAYKVLLGRRDSRTASKNDANTNLPPPFFNFSQLLSNFQSHGLNLTDLVVLSAGHTIGLARCTTFRDRIYNDTNINYKFAASLKYSCPRTGGDNNTKPFDSTTTRFDAQYFRDLLAKKGLLHSDQELFKGDGSGSDSLVKYYGYINPDRFLTDFSASMVKMGNMKPLTGTNGEIRMNCRKVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTATACAATCTTTCTTGTATTTTGCAACATTAGTGGCTATTTTGATCCCTGTAAGTGCACAGTTGACACCTGACTTCTACGACAAAGTGTGCCCTCAAGCCCTGCCAATCATT
AGAAAAATTACTAAGCAGGCAATCCGGCGTGAGCCACGTATGGGAGCTTCGCTGCTTCGAATGCATTTTCATGACTGCTTTGTCAAT
GTAAGTTTACTTCAAGCTTAAACTTCTTCACTT
TTCTATTGCTCAATATAGCAGACGTAGATGTTTAATGTTGCTTTGGCTTCAGGGTTGTGATGGATCAGTGCTTCTAGATGACACAGCCAACTTCACTGGAGAGAAGACAGCCCTTCCCAA
TTTGAATTCACTCAGGGGCTTTGAAGTGGTTGACCAAATTAAATCAGCTATTAACCAAGCTTGCTCTGCCAATGTGGTGTCATGTGCTGACATTTTAGCTGTCGCAGCTCGCGACTCTGT
GAACCTT
GTAAGCAGGCATTGATATTCTTATAGCATAAATCCAACTGTTTTTTATTTATTTTCCTCTTCTAAGAAGTTTCCTTTCATTATGATCTTTATTTGTGTGCAAGAATCATATCA
TTAATGAATCAAGCTTGTTTTTGTGTTGCAGCTGGGAGGTCCTGCGTACAAGGTGTTACTAGGCAGAAGAGATTCAAGAACTGCAAGCAAAAACGATGCAAACACCAATCTTCCTCCCCC
GTTTTTTAACTTCTCACAACTTCTCTCTAACTTCCAATCTCATGGGCTAAACCTGACGGACCTAGTTGTCCTCTCAGCAGGCCACACCATTGGACTTGCTCGGTGCACCACTTTCCGCGA
CAGGATTTACAACGACACCAATATAAACTACAAATTTGCTGCTTCCTTGAAATATAGCTGCCCAAGAACTGGAGGGGACAATAACACGAAGCCTTTTGATTCAACCACAACAAGATTTGA
TGCACAATATTTCAGGGATTTGCTTGCCAAAAAAGGTCTCCTACATTCTGACCAAGAGCTGTTTAAGGGTGATGGTAGTGGTAGCGATTCGCTAGTGAAGTATTATGGTTACATTAATCC
AGACAGATTTCTGACAGACTTCTCTGCTTCCATGGTCAAGATGGGAAATATGAAGCCCCTCACTGGAACTAATGGAGAGATCAGAATGAATTGCAGAAAAGTTAATAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTATACAATCTTTCTTGTATTTTGCAACATTAGTGGCTATTTTGATCCCTGTAAGTGCACAGTTGACACCTGACTTCTACGACAAAGTGTGCCCTCAAGCCCTGCCAATCATT
AGAAAAATTACTAAGCAGGCAATCCGGCGTGAGCCACGTATGGGAGCTTCGCTGCTTCGAATGCATTTTCATGACTGCTTTGTCAAT
GGTTGTGATGGATCAGTGCTTCTAGATGACACA
GCCAACTTCACTGGAGAGAAGACAGCCCTTCCCAATTTGAATTCACTCAGGGGCTTTGAAGTGGTTGACCAAATTAAATCAGCTATTAACCAAGCTTGCTCTGCCAATGTGGTGTCATGT
GCTGACATTTTAGCTGTCGCAGCTCGCGACTCTGTGAACCTT
CTGGGAGGTCCTGCGTACAAGGTGTTACTAGGCAGAAGAGATTCAAGAACTGCAAGCAAAAACGATGCAAACACCAAT
CTTCCTCCCCCGTTTTTTAACTTCTCACAACTTCTCTCTAACTTCCAATCTCATGGGCTAAACCTGACGGACCTAGTTGTCCTCTCAGCAGGCCACACCATTGGACTTGCTCGGTGCACC
ACTTTCCGCGACAGGATTTACAACGACACCAATATAAACTACAAATTTGCTGCTTCCTTGAAATATAGCTGCCCAAGAACTGGAGGGGACAATAACACGAAGCCTTTTGATTCAACCACA
ACAAGATTTGATGCACAATATTTCAGGGATTTGCTTGCCAAAAAAGGTCTCCTACATTCTGACCAAGAGCTGTTTAAGGGTGATGGTAGTGGTAGCGATTCGCTAGTGAAGTATTATGGT
TACATTAATCCAGACAGATTTCTGACAGACTTCTCTGCTTCCATGGTCAAGATGGGAAATATGAAGCCCCTCACTGGAACTAATGGAGAGATCAGAATGAATTGCAGAAAAGTTAATAAC
TAG

Retrieve as FASTA